HS3ST1 Antibody Middle region

• Gene Name:

  Heparan sulfate-glucosamine 3-sulfotransferase 1

• Gene Aliases:

  3OST, 3OST1

• Gene ID:

  9957

• Swiss Prot:

  O14792

• Accession Number:

  NP_005105.1

• Reactivity:

  Human

• Immunogen:

  The immunogen is a synthetic peptide directed towards the middle region of human HS3ST1

• Target:

  Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  FPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAH

• Applications:

  WB

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  36 kDa

• Protein Length:

  307

• NCBI Gene Symbol:

  HS3ST1

• Host or Source:

  Rabbit

• Protein Name:

  Heparan sulfate glucosamine 3-O-sulfotransferase 1

• Gene Name URL:

  HS3ST1

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_005114.2