Fkbp4 Antibody-N-terminal region

• Gene Name:

  FK506 binding protein 4

• Gene Aliases:

  P59, FKBP5, FKBP-4, FKBP-5, FKBP52, FKPB52, FKBP-52, AL022792, AW208983

• Gene ID:

  14228

• Swiss Prot:

  P30416

• Accession Number:

  NP_034349.1

• Reactivity:

  Mouse

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of mouse FKBP4

• Target:

  Immunophilin protein with PPIase and co-chaperone activities. Component of steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90) . May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments. The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening. Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly. May have a protective role against oxidative stress in mitochondria.

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  EGTGTETPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKA

• Applications:

  WB

• Purification:

  Affinity purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  52 kDa

• Protein Length:

  458

• NCBI Gene Symbol:

  FKBP4

• Host or Source:

  Rabbit

• Protein Name:

  Peptidyl-prolyl cis-trans isomerase FKBP4

• Gene Name URL:

  FKBP4

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_010219.3