LIN9 antibody - N-terminal region (ARP50821_P050)

• Gene Name:

  Lin-9 homolog (C. elegans)

• Gene Aliases:

  TGS, BARA, TGS1, TGS2, Lin-9, BARPsv

• Gene ID:

  286826

• Swiss Prot:

  B1B046

• Accession Number:

  CAI14231

• Reactivity:

  Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

• Immunogen:

  The immunogen is a synthetic peptide directed towards the N terminal region of human LIN9

• Target:

  LIN9 belongs to the lin-9 family and acts as a tumor suppressor. It inhibits DNA synthesis. Its ability to inhibit oncogenic transformation is mediated through its association with RB1. LIN9 plays a role in the expression of genes required for the G1/S transition.

• Partner Proteins:

  MYBL2; E2F4; RBL2; LIN54; LIN52; LIN37; RBL1; RBBP4; UBC; LIN9; TFDP2; TFDP1; MYBL1; RB1

• Clonality:

  Polyclonal

• Type:

  Polyclonal Antibody

• Sequence:

  TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA

• Applications:

  WB

• Purification:

  Affinity Purified

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Concentration:

  0.5 mg/ml

• Homology:

  Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

• Format:

  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

• Reconstitution:

  For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

• Molecular Weight:

  53kDa

• Protein Length:

  490

• NCBI Gene Symbol:

  LIN9

• Host or Source:

  Rabbit

• Protein Name:

  Lin-9 homolog (C. elegans) EMBL CAI14231.1

• Gene Name URL:

  LIN9

• CAS Number:

  9007-83-4

• Nucleotide Accession Number:

  NM_001270409