Recombinant Halalkalibacterium halodurans Putative adenine deaminase BH0637 (BH0637), partial

CAT:
399-CSB-EP864561BQS-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Halalkalibacterium halodurans Putative adenine deaminase BH0637 (BH0637), partial - image 1

Recombinant Halalkalibacterium halodurans Putative adenine deaminase BH0637 (BH0637), partial

  • Product Name Alternative:

    BH0637; Putative adenine deaminase BH0637; Adenase; Adenine aminase; EC 3.5.4.2
  • Abbreviation:

    Recombinant Halalkalibacterium halodurans BH0637 protein, partial
  • Gene Name:

    BH0637
  • UniProt:

    Q9KF49
  • Expression Region:

    1-328aa
  • Organism:

    Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) (Bacillus halodurans)
  • Target Sequence:

    MCEQKYRWTKKQIRQQLAVVRGEMAPTLVLKNATYLNSVRGKWLDANIWIYQDRIVYVGQDMPAKLDDETEVVDCGQQVIVPGYIEHHAHPFQLYNPHSFANYAAAMGTTTLINDNLMFFLALEKKKALSMIESLDELPSSMYWWCRYDPQTEMNDEEGHFLNSKIKEWLEHPLVVQGGELTSWPKVITGDDGILHWMQETRRLRKPIEGHFPGASEKTLTQMSLLGVTSDHEAMTGEEVIRRLDLGYMTSLRHSSIRSDLAKILREMKELGIDDFSRCMLTTDGSPPSFYEQGIMDRLIKIALDEGIPPKDAYGMATYYVARYYGLD
  • Tag:

    N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    57.7 kDa
  • References & Citations:

    "Complete genome sequence of the alkaliphilic bacterium Bacillus halodurans and genomic sequence comparison with Bacillus subtilis." Takami H., Nakasone K., Takaki Y., Maeno G., Sasaki R., Masui N., Fuji F., Hirama C., Nakamura Y., Ogasawara N., Kuhara S., Horikoshi K. Nucleic Acids Res. 28:4317-4331 (2000)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial