Recombinant Human Titin (TTN), partial

CAT: 0399-CSB-EP025267HU-01Size: 20 µgDry Ice: NoHazardous: No
CAT#:0399-CSB-EP025267HU-01Size:20 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Product Name Alternative
Connectin Rhabdomyosarcoma antigen MU-RMS-40.14
Abbreviation
Recombinant Human TTN protein, partial
Gene Name
TTN
UniProt
Q8WZ42
Expression Region
14257-14543aa
Organism
Homo sapiens (Human)
Target Sequence
RCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGG
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Type
In Stock Protein
Source
E.coli
Field of Research
Epigenetics and Nuclear Signaling
Relevance
Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Function
Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.
Molecular Weight
36.9 kDa
References & Citations
"Series of exon-skipping events in the elastic spring region of titin as the structural basis for myofibrillar elastic diversity." Freiburg A., Trombitas K., Hell W., Cazorla O., Fougerousse F., Centner T., Kolmerer B., Witt C., Beckmann J.S., Gregorio C.C., Granzier H., Labeit S. Circ. Res. 86:1114-1121 (2000)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial

Related Products

CatalogName
CSB-EP025267MO-01Recombinant Mouse Titin (Ttn), partial
CSB-EL025267HU-01Human Titin (TTN) ELISA kit
CSB-RA025267MA1HU-01TTN Recombinant Monoclonal Antibody
CSB-PA15079A0Rb-01TTN Antibody
CSB-PA15079B0Rb-01TTN Antibody, HRP conjugated
CSB-PA15079C0Rb-01TTN Antibody, FITC conjugated
CSB-E13356h-01Human titin antibody (IgG) ELISA Kit
CSB-PA15079D0Rb-01TTN Antibody, Biotin conjugated
CSB-EP719626HUg5-01Recombinant Human Focadhesin (FOCAD), partial
CSB-EP001703HU1-01Recombinant Human Angiogenin (ANG), partial

Alternative Products

CatalogName
AP72278-01Recombinant Human Titin(TTN), partial
RPC30779-01Recombinant Human Titin (TTN), partial
RPC20209-01Recombinant Human Titin (TTN) ,partial
AP77524Recombinant Human Titin (TTN) , partial
MBS1196964-01Recombinant Mouse Titin (Ttn), partial
abx069344-01Human Titin (TTN) Protein
157050-01Titin (TTN) Recombinant, Human
RPU44054-01Recombinant Human Titin (TTN)
FY-EH1788Human Ttn (Titin) ELISA Kit
QY-E03054Human Titin (TTN) ELISA Kit

Popular Products