Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit (polC), partial

CAT:
399-CSB-EP370095DRA-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit (polC), partial - image 1

Recombinant Cenarchaeum symbiosum DNA polymerase II large subunit (polC), partial

  • Product Name Alternative:

    PolC; CENSYa_1827DNA polymerase II large subunit; Pol II; EC 2.7.7.7; Exodeoxyribonuclease large subunit; EC 3.1.11.1
  • Abbreviation:

    Recombinant Cenarchaeum symbiosum polC protein, partial
  • Gene Name:

    PolC
  • UniProt:

    A0RYM0
  • Expression Region:

    287-832aa
  • Organism:

    Cenarchaeum symbiosum (strain A)
  • Target Sequence:

    LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA
  • Tag:

    Tag-Free
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Possesses two activities
  • Molecular Weight:

    59 kDa
  • References & Citations:

    "Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum symbiosum." Hallam S.J., Konstantinidis K.T., Putnam N., Schleper C., Watanabe Y., Sugahara J., Preston C., de la Torre J., Richardson P.M., DeLong E.F. Proc. Natl. Acad. Sci. U.S.A. 103:18296-18301 (2006)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial