Recombinant Naja kaouthia Alpha-cobratoxin

CAT:
399-CSB-EP365543NAF-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Naja kaouthia Alpha-cobratoxin - image 1

Recombinant Naja kaouthia Alpha-cobratoxin

  • Product Name Alternative:

    Alpha-elapitoxin-Nk2a Short name:Alpha-EPTX-Nk2a Long neurotoxin 1 Siamensis 3
  • Abbreviation:

    Recombinant Naja kaouthia Alpha-cobratoxin protein
  • UniProt:

    P01391
  • Expression Region:

    1-71aa
  • Organism:

    Naja kaouthia (Monocled cobra) (Naja siamensis)
  • Target Sequence:

    IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP
  • Tag:

    N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Monomer: binds with high affinity to muscular (alpha-1-beta-1-gamma-delta (CHRNA1/CHRNB1/CHRNG/CHRND) nAChR) (IC50=4.5 nM on Torpedo californica membranes) and neuronal alpha-7/CHRNA7 nicotinic acetylcholine receptors (IC50=105 nM) .2 Publications Homodimer: binds with high affinity (but lower than the monomeric form) to muscular (IC50=9.7 nM) and with low affinity to neuronal alpha-7/CHRNA7 nAChRs (IC50=1370 nM) .However, it acquires (compared to the monomeric form) the capacity to block alpha-3/beta-2 (CHRNA3/CHRNB2) nAChRs Heterodimer with cytotoxin 3 (AC P01446) : is slightly more active than the homodimer in inhibiting alpha-7 nAChR and is considerably more active in blocking the alpha-3-beta-2 nAChR. The monomeric form has no effect on alpha-3/beta-2 (CHRNA3/CHRNB2) nAChR. It does not show any blockade of the nicotine-evoked release of dopamine and does not affect ACh release.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 85% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Monomer
  • Molecular Weight:

    37.8 kDa
  • References & Citations:

    "Naturally occurring disulfide-bound dimers of three-fingered toxins: a paradigm for biological activity diversification." Osipov A.V., Kasheverov I.E., Makarova Y.V., Starkov V.G., Vorontsova O.V., Ziganshin R.K., Andreeva T.V., Serebryakova M.V., Benoit A., Hogg R.C., Bertrand D., Tsetlin V.I., Utkin Y.N. J. Biol. Chem. 283:14571-14580 (2008)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length