Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE (glpE)

CAT:
399-CSB-YP533026ENP-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE (glpE) - image 1

Recombinant Escherichia coli Thiosulfate sulfurtransferase GlpE (glpE)

  • Product Name Alternative:

    GlpE; EcolC_0289; Thiosulfate sulfurtransferase GlpE; EC 2.8.1.1
  • Abbreviation:

    Recombinant E.coli glpE protein
  • Gene Name:

    GlpE
  • UniProt:

    B1IP41
  • Expression Region:

    1-108aa
  • Organism:

    Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
  • Target Sequence:

    MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    Developed Protein
  • Source:

    Yeast
  • Field of Research:

    Microbiology
  • Relevance:

    Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Catalyzes, although with low efficiency, the sulfur transfer reaction from thiosulfate to cyanide.
  • Molecular Weight:

    14.1 kDa
  • References & Citations:

    "Complete sequence of Escherichia coli C str. ATCC 8739."Copeland A., Lucas S., Lapidus A., Glavina del Rio T., Dalin E., Tice H., Bruce D., Goodwin L., Pitluck S., Kiss H., Brettin T., Detter J.C., Han C., Kuske C.R., Schmutz J., Larimer F., Land M., Hauser L. Richardson P.Submitted (FEB-2008)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length