Recombinant Phleum pratense Pollen allergen Phl p 5b, partial

CAT:
399-CSB-EP671435EUQ-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Phleum pratense Pollen allergen Phl p 5b, partial - image 1

Recombinant Phleum pratense Pollen allergen Phl p 5b, partial

  • Product Name Alternative:

    Allergen Phl p Vb Allergen: Phl p 5b
  • Abbreviation:

    Recombinant Phleum pratense Pollen allergen Phl p 5b protein, partial
  • UniProt:

    Q40963
  • Expression Region:

    20-284aa
  • Organism:

    Phleum pratense (Common timothy)
  • Target Sequence:

    ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV
  • Tag:

    N-terminal 6xHis-SUMO-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Others
  • Relevance:

    Has ribonuclease activity. May be involved in host-pathogen interactions.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Has ribonuclease activity. May be involved in host-pathogen interactions.
  • Molecular Weight:

    42.1 kDa
  • References & Citations:

    "Major allergen Phl p Vb in timothy grass is a novel pollen RNase."Bufe A., Schramm G., Keown M.B., Schlaak M., Becker W.M.FEBS Lett. 363:6-12 (1995)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial