Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH)

CAT:
399-CSB-YP362349ENV-02
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH) - image 1

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin (fimH)

  • Product Name Alternative:

    FimH; b4320; JW4283Type 1 fimbrin D-mannose specific adhesin; Protein FimH
  • Abbreviation:

    Recombinant E.coli fimH protein
  • Gene Name:

    FimH
  • UniProt:

    P08191
  • Expression Region:

    22-300aa
  • Organism:

    Escherichia coli (strain K12)
  • Target Sequence:

    FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
  • Tag:

    N-terminal 6xHis-tagged
  • Type:

    In Stock Protein
  • Source:

    Yeast
  • Field of Research:

    Others
  • Relevance:

    Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae) . Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae) . Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
  • Molecular Weight:

    31.1 kDa
  • References & Citations:

    Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.Hung C.S., Bouckaert J., Hung D., Pinkner J., Widberg C., DeFusco A., Auguste C.G., Strouse R., Langermann S., Waksman G., Hultgren S.J.Mol. Microbiol. 44:903-915 (2002)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length of Mature Protein