Recombinant Human PCNA-associated factor (PCLAF)

CAT:
399-CSB-EP012164HU-03
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human PCNA-associated factor (PCLAF) - image 1

Recombinant Human PCNA-associated factor (PCLAF)

  • Product Name Alternative:

    Hepatitis C virus NS5A-transactivated protein 9 ; HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ; OEATC-1; PCNA-associated factor of 15KDA ; PAF15 ; p15PAF
  • Abbreviation:

    Recombinant Human PCLAF protein
  • Gene Name:

    PCLAF
  • UniProt:

    Q15004
  • Expression Region:

    1-111aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
  • Tag:

    N-terminal GST-tagged
  • Type:

    In Stock Protein
  • Source:

    E.coli
  • Field of Research:

    Metabolism
  • Relevance:

    PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
  • Endotoxin:

    Not test
  • Purity:

    Greater than 90% as determined by SDS-PAGE.
  • Activity:

    Not Test
  • Form:

    Liquid or Lyophilized powder
  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Function:

    PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.
  • Molecular Weight:

    39 kDa
  • References & Citations:

    KIAA0101 is overexpressed, and promotes growth and invasion in adrenal cancer.Jain M., Zhang L., Patterson E.E., Kebebew E.PLoS ONE 6:E26866-E26866 (2011)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Full Length