Recombinant Human PH-Like Domain A2/PHLDA2/BWR1C/IPL/TSSC3 (C-6His)

  • Catalog number
    CF45-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human PHLDA2 is produced by our E.coli expression system and the target gene encoding Met1-Pro152 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTPLEHHHHHH
  • Estimated molecular weight
    18,1 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM Tris, 0.1M NaCl, 1mM DTT, pH 8.0.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q53GA4
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PHLDA2, PAH, SPAM1, ADAM2, ADAM1A, P4HTM
  • Short name
    Recombinant PH-Like Domain A2/PHLDA2/BWR1C/IPL/TSSC3 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human PHLDA2/BWR1C/IPL/TSSC3(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    pleckstrin homology-like domain, family A, member 2, BRW1C and BWR1C and HLDA2 and IPL and TSSC3, PHLDA2 and IDBG-23772 and ENSG00000181649 and 7262, Plasma membranes, Phlda2 and IDBG-212749 and ENSMUSG00000010760 and 22113, PHLDA2 and IDBG-645159 and ENSBTAG00000031194 and 618810
Gene info
  • Identity
  • Gene
  • Long gene name
    pleckstrin homology like domain family A member 2
  • Synonyms gene
  • Synonyms gene name
    • tumor suppressing subtransferable candidate 3
    • pleckstrin homology-like domain, family A, member 2
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-06-22
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Pleckstrin homology domain containing
  • VEGA ID
  • Locus Specific Databases
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    ADAM metallopeptidase domain 1A (pseudogene)
  • Synonyms gene
  • Synonyms gene name
    • a disintegrin and metalloproteinase domain 1 (fertilin alpha) pseudogene
    • ADAM metallopeptidase domain 1, pseudogene
    • ADAM metallopeptidase domain 1A, pseudogene
  • Synonyms
  • Synonyms name
  • GenBank acession
  • Locus
  • Discovery year
    1998-12-01
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • ADAM metallopeptidase domain containing
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee