-
Description
Recombinant Mouse Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Lys26-Ala189 is expressed.
-
Species reactivity
Mouse
-
Origin
Escherichia coli
-
Peptide sequence
MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
-
Estimated molecular weight
18,4 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
P20826
-
-
Additional description
For cells, cell lines and tissues in culture till half confluency. Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain. Stem cell factors and stem cell growth factors will produce stem cells or be part of a transdifferentiation process to produce other cells. A cell can transdifferentiate by going back to the naive stem cell stadium or directly into the other cell, helped by the stem cell and transdifferentiationf actors. Stem cell growth factors or stem cell factors are mostly used to produce iPSCs or induced pluripotent stem cells by Jamaka or Thomson factors by using for example 5 Lenti-III-CMV viruses, expressing the Yamanaka iPSC factor set (Oct4, Sox2, Nanog and Lin28) + GFP positive control. Trans differentiation will omit the stem cell stadium but stem cell factors sill play an important role in trans differentiation strategies.
-
Latin name
Mus musculus
-
Source
Recombinants or rec. proteins
-
Group
recombinants
