Recombinant Mouse Lithostathine-1(Reg1)

• Catalog number
  RPC20409
• Price
  Please ask
• Size
  500 μg

• Verified reactivity
  Mus musculus (Mouse)
• Protein number
  P43137
• Gene number
  Reg1
• Other name
  Islet of Langerhans regenerating protein 1; Short name:REG 1; Pancreatic stone protein 1; Short name:PSP; Pancreatic thread protein 1; Short name:PTP; Regenerating protein 1
• Protein origin
  E.coli
• Protein region
  22-165aa
• Protein sequence
  QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
• Information about sequence
  Full Length of Mature Protein
• Expected molecular weight
  31.84kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Lithostathine-1   Reg1  
• Short name
  Recombinant Mouse Lithostathine-1(Reg1)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Mouse, Mouses
• Alternative name
  Rec. Mouse Lithostathine-1(Reg1)
• Alternative technique
  rec, murine

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products