Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial

• Catalog number
  RPC20276
• Price
  Please ask
• Size
  200 μg

• Verified reactivity
  Mus musculus (Mouse)
• Protein number
  O35659
• Gene number
  Glp1r
• Other name
  Short name:; GLP-1 receptor; Short name:; GLP-1-R; Short name:; GLP-1R
• Protein origin
  E.coli
• Protein region
  22-145aa
• Protein sequence
  GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
• Information about sequence
  Extracellular Domain
• Expected molecular weight
  30.38kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Glucagon gene and the glucagon like peptide or GLP1 gene are peptide hormones, produced by alpha cells of the pancreas to raise the concentration of glucose in the blood as opposite of insulin, which lowers the glucose. Anti human glucagon and glp1 antibodies are used to study diabetes. Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Glucagon-like   peptide   receptor   Glp1r   partial  
• Short name
  Recombinant Mouse Glucagon-like peptide 1 receptor(Glp1r),partial
• Technique
  Recombinant, peptide, Mouse, mouses, peptides, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Mouse, Mouses
• Alternative name
  Rec. Mouse Glucagon-like short protein sequence 1 receptor(Glp1r),partial
• Alternative technique
  rec, peptides, murine

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products