Recombinant Marmoset T Cell Ig and Mucin Domain-3/TIM3/HAVCR2 (C-6His)

  • Catalog number
    CM64-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Marmoset TIM-3 is produced by our Mammalian expression system and the target gene encoding Glu24-Ile193 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Marmoset
  • Origin
    Human cells
  • Peptide sequence
    EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRIHHHHHH
  • Estimated molecular weight
    19,7 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    F7I881
  • Additional description
    For cells, cell lines and tissues in culture till half confluency.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    HAVCR2
  • Short name
    Recombinant Marmoset T Ig Mucin Domain-3/TIM3/HAVCR2 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative name
    Marmoset TIM-3/HAVCR2(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    hepatitis A virus cellular receptor 2, HAVCR2 and IDBG-55271 and ENSG00000135077 and 84868, protein binding, Plasma membranes, Havcr2 and IDBG-165782 and ENSMUSG00000020399 and 171285
  • Tissue
    cell
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee