Recombinant Human SH2 Domain-Containing Protein 1A/SH2D1A/SAP/DSHP (N-6His)

  • Catalog number
    CF35-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human SH2D1A is produced by our E.coli expression system and the target gene encoding Met1-Pro128 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MGSSHHHHHHSSGLVPRGSHMDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
  • Estimated molecular weight
    16,3 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    O60880
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    SH2D1A, GM2A, PTPRH, APCS, DLG1, DLG4, DLG3
  • Short name
    Recombinant SH2 Domain- Protein 1A/SH2D1A/SAP/DSHP (N-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human SH2D1A/SAP/DSHP(N-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    SH2 domain containing 1A, DSHP and EBVS and IMD5 and LYP and MTCP1 and SAP and SAP/SH2D1A and XLP and XLPD and XLPD1, SH2D1A and IDBG-85368 and ENSG00000183918 and 4068, protein binding, Cytoplasm, Sh2d1a and IDBG-141610 and ENSMUSG00000005696 and 20400, SH2D1A and IDBG-630222 and ENSBTAG00000026067 and 613356
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    protein tyrosine phosphatase receptor type H
  • Synonyms
  • Locus
  • Discovery year
    1994-09-14
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Protein tyrosine phosphatases receptor type
    • Fibronectin type III domain containing
  • VEGA ID
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    discs large MAGUK scaffold protein 4
  • Synonyms gene name
    • discs, large homolog 4 (Drosophila)
    • discs large homolog 4
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1995-11-07
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Membrane associated guanylate kinases
    • PDZ domain containing
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee