Recombinant Human respiRatory syncytial virus B Fusion glycoprotein F0(F),partial

• Catalog number
  RPC20263
• Price
  Please ask
• Size
  100 μg

• Verified reactivity
  Homo sapiens (Human)
• Protein number
  O36634
• Gene number
  F
• Other name
  no alternative name
• Protein origin
  Yeast
• Protein region
  137-574aa
• Protein sequence
  FLGFLLGVGSAIASGIAVSKVLHLEGEVNKIKNALLSTNKAVVSLSNGVSVLTSKVLDLKNYINNQLLPIVNQQSCRISNIETVIEFQQKNSRLLEINREFSVNAGVTTPLSTYMLTNSELLSLINDMPITNDQKKLMSSNVQIVRQQSYSIMSIIKEEVLAYVVQLPIYGVIDTPCWKLHTSPLCTTNIKEGSNICLTRTDRGWYCDNAGSVSFFPQADTCKVQSNRVFCDTMNSLTLPSEVSLCNTDIFNSKYDCKIMTSKTDISSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKLEGKNLYVKGEPIINYYDPLVFPSDEFDASISQVNEKINQSLAFIRRSDELLHNVNTGKSTTNIMITTIIIVIIVVLLSLIAIGLLLYCKAKNTPVTLSKDQLSGINNIAFSK
• Information about sequence
  Partial
• Expected molecular weight
  50.11kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Fusion proteins or chimeric proteins are proteins created through the joining of two or more genes that originally coded for separate proteins. A GFP gene is often used as tag to a reporter gene. Fusion lentiverctors can be used as viral particles to produce proteins that carry for example a GFP tag. Antigen purification of recombinant fusion tag proteins is a frequent strategy using a Fralg tag.
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  respiRatory   syncytial   virus   glycoprotein   partial  
• Short name
  Recombinant respiRatory syncytial virus B glycoprotein F0(F),partial
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-tagged
• Species
  Virus, Humans, Viruses
• Alternative name
  Rec. H. sapiens respiRatory syncytial virus B Fusion glycoprotein F0(F),partial
• Alternative technique
  rec
• Virus
  respiratory, syncytial

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products