Recombinant Human GITR/TNFRSF18/CD357 (C-Fc)

• Catalog number
  CP23-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human GITR is produced by our Mammalian expression system and the target gene encoding Gln26-Gln161 is expressed with a Fc tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Estimated molecular weight
  41.2
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q9Y5U5
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  GITR/TNFRSF18/CD357   C-Fc  
• Gene symbol
  TNFRSF18
• Short name
  Recombinant GITR/TNFRSF18/CD357 (C-Fc)
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human GITR/TNFRSF18/CD357(C-Fc)
• Alternative technique
  rec
• Alternative to gene target
  tumor necrosis factor receptor superfamily, member 18, AITR and CD357 and GITR and GITR-D, TNFRSF18 and IDBG-84584 and ENSG00000186891 and 8784, protein binding, Extracellular, Tnfrsf18 and IDBG-208288 and ENSMUSG00000041954 and 21936, TNFRSF18 and IDBG-635325 and ENSBTAG00000015632 and 516256

Gene info

• Identity
  HGNC:11914
• Gene
  TNFRSF18
• Long gene name
  TNF receptor superfamily member 18
• Synonyms gene name
  • tumor necrosis factor receptor superfamily, member 18
• Synonyms
  • AITR
  • GITR
  • CD357
• GenBank acession
  • AF125304
• Locus
  1p36.33
• Discovery year
  1998-12-04
• Entrez gene record
  8784
• Pubmed identfication
  • 9177197
  • 10037686
• RefSeq identity
  • NM_004195
• Classification
  • Tumor necrosis factor receptor superfamily
  • CD molecules
• VEGA ID
  OTTHUMG00000001414

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products