Recombinant Human Connective tissue growth factor(CTGF),partial

  • Catalog number
    RPC20192
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P29279
  • Gene number
    CTGF
  • Other name
    CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8 ; IBP-8 ; IGF-binding protein 8 ; IGFBP-8
  • Protein origin
    E.coli
  • Protein region
    253-349aa
  • Protein sequence
    GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
  • Information about sequence
    Partial
  • Expected molecular weight
    15.2kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. 6
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CCN2, CCN5
  • Short name
    Recombinant Connective tissue growth factor(CTGF),partial
  • Technique
    Recombinant, tissue, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture. tissues
  • Label
    N-terminal 6xHis-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Connective tissue growth factor(connective tissue growth factor),partial
  • Alternative technique
    rec, tissues
  • Alternative to gene target
    connective tissue growth factor, CCN2 and HCS24 and IGFBP8 and NOV2, CTGF and IDBG-96631 and ENSG00000118523 and 1490, heparin binding, Extracellular, Ctgf and IDBG-138628 and ENSMUSG00000019997 and 14219, CTGF and IDBG-633353 and ENSBTAG00000006367 and 281103
  • Tissue
    tissue
Gene info
  • Identity
  • Gene
  • Long gene name
    cellular communication network factor 2
  • Synonyms gene
  • Synonyms gene name
    • connective tissue growth factor
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1992-12-01
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Cellular communication network factors
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The technique of using FIXATIVES in the preparation of cytologic, histologic, or pathologic specimens for the purpose of maintaining the existing form and structure of all the constituent elements.
  • Tree numbers
    • E01.370.225.500.620.760.720
    • E01.370.225.750.600.760.720
    • E05.200.500.620.760.720
    • E05.200.750.600.760.720
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee