Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2

  • Catalog number
    CM22-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human CTGF is produced by our Mammalian expression system and the target gene encoding Glu27-Ala180 is expressed.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
  • Estimated molecular weight
    16,3 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P29279
  • Additional description
    Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells. 6
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CCN2, CCN2-AS1, CCN5
  • Short name
    Recombinant Connective Tissue Growth Factor/CTGF/CCN2
  • Technique
    Recombinant, tissue, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture. tissues
  • Species
    Human, Humans
  • Alternative name
    Human CTGF/CCN2
  • Alternative technique
    rec, tissues
  • Alternative to gene target
    connective tissue growth factor, CCN2 and HCS24 and IGFBP8 and NOV2, CTGF and IDBG-96631 and ENSG00000118523 and 1490, heparin binding, Extracellular, Ctgf and IDBG-138628 and ENSMUSG00000019997 and 14219, CTGF and IDBG-633353 and ENSBTAG00000006367 and 281103
  • Tissue
    tissue
Gene info
  • Identity
  • Gene
  • Long gene name
    cellular communication network factor 2
  • Synonyms gene
  • Synonyms gene name
    • connective tissue growth factor
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1992-12-01
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Cellular communication network factors
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    CCN2 antisense RNA 1
  • Locus
  • Discovery year
    2021-07-30
  • Classification
    • Antisense RNAs
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee