Recombinant Human Basal Cell Adhesion Molecule/BCAM (C-6His)

  • Catalog number
    CU19-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human Basal Cell Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Glu32-Ala547 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPAPKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAHYSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPEYTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAYLDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAHHHHHH
  • Estimated molecular weight
    57 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P50895
  • Additional description
    cell adhesion molecules play a role in cell growth and activation and are often identified by WB or ELISA as in the Recombinant Basal Adhesion Molecule/BCAM (C-6His). For cells, cell lines and tissues in culture till half confluency. Whole adhesion and interacting molecules are  present in lysates used as reference for ELISA quantification of these molecules and their subunits.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    BCAM, BCAT2
  • Short name
    Recombinant Basal Adhesion Molecule/BCAM (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Recombinant Human BCAM (C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    basal cell adhesion molecule (Lutheran blood group), AU and CD239 and LU and MSK19, BCAM and IDBG-56639 and ENSG00000187244 and 4059, laminin binding, Cell surfaces, Bcam and IDBG-152453 and ENSMUSG00000002980 and 57278, BCAM and IDBG-639282 and ENSBTAG00000009495 and 282862
  • Tissue
    cell
Gene info
  • Identity
  • Gene
  • Long gene name
    basal cell adhesion molecule (Lutheran blood group)
  • Synonyms gene
  • Synonyms gene name
    • Lutheran blood group (Auberger b antigen included)
    • basal cell adhesion molecule (Lu and Au blood groups)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2001-06-22
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Blood group antigens
    • CD molecules
    • Ig-like cell adhesion molecule family
    • C2-set domain containing
  • VEGA ID
  • Locus Specific Databases
Gene info
  • Identity
  • Gene
  • Long gene name
    branched chain amino acid transaminase 2
  • Synonyms gene
  • Synonyms gene name
    • branched chain aminotransferase 2, mitochondrial
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2001-06-22
  • Entrez gene record
    587
  • Pubmed identfication
  • Classification
    • Minor histocompatibility antigens
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee