HLA-DPA1 Blocking Peptide

  • Catalog number
    33R-2275
  • Price
    Please ask
  • Size
    100 µg
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Immunology
  • Residues
    EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
  • Type of protein
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • URL
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
  • Gene symbol
    HLA-DPA1, HLA-DPA2, HLA-DOA, HLA-DQA1, HLA-N, HLA-DQA2, HLA-DPB1, HLA-DQB2, HLA-W, HLA-DRA
  • Short name
    HLA-DPA1 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative name
    A synthetic peptide for use as a blocking control in assays to test for specificity of HLA-DPA1 antibody, catalog no. 70R-5980
  • Alternative technique
    control, peptides
  • Alternative to gene target
    major histocompatibility complex, class II, DP alpha 1, DP(W3) and DP(W4) and HLA-DP1A and HLADP and HLASB and PLT1, HLA-DPA1 and IDBG-81778 and ENSG00000231389 and 3113, peptide antigen binding, Cell surfaces
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Testing erythrocytes to determine presence or absence of blood-group antigens, testing of serum to determine the presence or absence of antibodies to these antigens, and selecting biocompatible blood by crossmatching samples from the donor against samples from the recipient. Crossmatching is performed prior to transfusion.
  • Tree numbers
    • E01.370.225.625.120
    • E01.370.225.812.385.120
    • E05.200.625.120
    • E05.200.812.385.120
    • E05.478.594.385.120
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee