-
Stock availability
In Stock
-
Scientific context
HSP65 isolated from Mycobacterium bovis BCG, is a member of the HSP60 family of heat shock proteins (2, 3). HSP60s are mitochondrial chaperonins that are typically held responsible for the transportation and refolding of proteins from the cytoplasm into the mitochondrial matrix. In addition to its role as a heat shock protein, HSP60 functions as a chaperonin to assist in folding linear amino acid chains into their respective three-dimensional structure. HSP60s are a ubiquitous class of HSPs that specifically promote the folding and assembly of cellular polypeptides in an ATP-dependent manner (1). Specifically, sequence comparison of HSP65 from different mycobacterium strains showed that the protein sequence of M. bovis BCG is identical to that of M. tuberculosis, and very similar to that of M. leprae, the pathogens that cause tuberculosis and tuberculoid leprosy, respectively (2,4). Mycobacterium bovis BCG HSP65 was identified as the immunodominant antigen during mycobacterial diseases and vaccination. It is also believed to be the antigen that induces autoimmune disease, such as adjuvant arthritis in rats (5, 6).
-
Protein target
HSP65
-
Protein reactivity
Mycobacterium bovis BCG
-
Certificate of analysis
This product has been certified >90% pure using SDS-PAGE analysis.
-
Protein description
Mycobacterium bovis BCG Recombinant HSP65 Partial Protein
-
Other name
60kDa chaperonin 2 Protein, Antigen A Protein, Cell wall protein A Protein, groEL Protein, GroEL2 Protein, GroL2 Protein, M. Tuberculosis cell wall protein A Protein, M. Tuberculosis HSP65 Protein, Protein Cpm60 2 Protein
-
Primary research area
Cancer, Heat Shock
-
Category
Protein
-
Brand name
none
-
Origin
Recombinant
-
NCBI number
AAQ64501.1
-
Protein number
Q1EHB9
-
Verified applications
WB, SDS-PAGE, Functional Assay, ELISA
-
Protein expression model
E. coli
-
Protein charasterics
Partial
-
Peptide sequence
EDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAISAGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISGYFVTDPERQEAVLEDPYILLVSSKVSTVKDLLPLXXXXXXXGKPLLIIAEDVEGEALSTLV
-
Protein purification
Multi-Step Purified
-
Purity pourcentage
>90% High purity
-
Recommended buffer for storage
20mM Tris, 150mM NaCl, 10% glycerol
-
Protein concentration
Lot/batch specific. See included datasheet.
-
Protein specificity
~65 kDa
-
Protein tag
No tag
-
Storage recommendations
-20°C
-
Shipping recommendations
Blue Ice or 4°C
-
Supplementary useful information
Please see included datasheet or contact us
-
Protein cell localization
Cytoplasm
-
Bibliography
1. Koll H., et al. (1992) Cell. 68: 1163-1175. 2. Thole J.E.R., et al. (1985) Infect. Immuno. 50: 800-806. 3. Thole J.E.R., et al., (1987) Infect. Immuno. 55: 1466-1475. 4. Shinnick T.M. Sweetser D., Thole J., van Embden J. and Young R.A. (1987) Infect. Immuno. 55: 1932-1935. 5. Van Eden W., et al. (1988) Nature 331: 171-178. 6. Cobelens P.M., et al. (2002) Rheumatology 41: 775-779.
-
Release date
1-May-2008
-
PubMed number
27742830, 17920518, 26925118, 25463133, 24066722
-
Tested applications
Functional Assay, Functional Assay, ELISA, Functional Assay, Western Blot Control
-
Tested species reactivity
Human, Mouse, M. bovis
-
-
Representative figure legend
SDS-PAGE of 65kDa M. Bovis Hsp65 protein (SPR-116). SDS-Page of M. Bovis HSP65 Protein (SPR-116)
-
Warnings
Non-hazardous materials
-
Protein origin
Canada
-
Total weight kg
1.4
-
Net weight g
0.2
-
-
Source
Recombinants or rec. proteins
-
Group
recombinants