Min length of search pharse is two chars

Filters

MMP 2 (Progelatinase A) (Recombinant Protein)

  • Catalog number
    30 100 603
  • Product name
    MMP 2 (Progelatinase A) (Recombinant Protein)
  • Size
    200 µg/ 1 ml
  • Price
    3804.04
  • Supplier
    biotez
  • Protein type
    Recombinant
  • Protein subtype
    EC 3.4.24.24
  • Protein family
    Matrix Metalloproteinases, matrixins
  • Protein description
    MMP2 is a ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly- -Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.
  • Research area interests
    Diseases associated with MMP2 include Multicentric Osteolysis, Nodulosis, And Arthropathy and Multicentric Osteolysis Of Torg. Among its related pathways are Pathways in cancer and Integrin Pathway
  • Package form
    liquid
  • Tested applications
    Degradation of extracellular Matrix; Screening and evaluation of MMP inhibitors; Antigen standard
  • Other names
    Matrix Metalloproteinase 2, Progelatinase A, a 72kDa Type IV Collagenase
  • Peptide sequence
    MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
  • Available target modification
    No
  • Expression system
    Insect Cell
  • Product Subtype
    full length
  • Active form?
    Yes,after APMA activation
  • Tag
    untagged
  • Contents
    50 mM Tris-HCl, pH 7.0, 200 mM NaCl, 5 mM CaCl2, 0.05 % Brij-35
  • Protein purity
    > 95 %
  • Molecular weight
    72 kDa
  • UniProt number
    P08253
  • Gene number
    4313
  • Abbreviation
    MMP2
  • Full name
    matrix metallopeptidase 2
  • Other desciption
    MMP2 is expressed in Sf9-insect cells using the baculovirus expression vector system and purified from cell culture supernatant.
  • Purification
    Mentioned in the data sheet
  • PubMed citations
    See the data sheet
  • Warnings
    For Research Use only.
  • Shipping conditions
    dry ice
  • Storage condition
    Store at -70°C
  • Technical datasheet
    Contact us to receive the datasheet
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    MMP 2 (Progelatinase A) (Recombinant Protein)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. biotez advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative name
    MMP 2 (Progelatinase A) (recombinant Protein)
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note:The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    classification, economics, history, instrumentation, methods, standards, trends, utilization, veterinary, statistics & numerical data, ethics
Additional information
Related products
Chat with gentaur.com employee