Rabbit CFP antibody
-
Catalog number70R-5909
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaSignal Transduction
-
ImmunogenCFP antibody was raised using the middle region of CFP corresponding to a region with amino acids SMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEE
-
SpecificityCFP antibody was raised against the middle region of CFP
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CFP antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolCFP
-
Short nameRabbit CFP antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal CFP antibody raised against the middle region of CFP
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetcomplement factor properdin, BFD and PFC and PFD and PROPERDIN, CFP and IDBG-61793 and ENSG00000126759 and 5199, Extracellular, Cfp and IDBG-135734 and ENSMUSG00000001128 and 18636, CFP and IDBG-636742 and ENSBTAG00000015815 and 539605
-
Gene info
-
Identity
-
Gene
-
Long gene namecomplement factor properdin
-
Synonyms gene
-
Synonyms gene name
- properdin P factor, complement
-
GenBank acession
-
Locus
-
Discovery year1989-06-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Complement system activation components
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data