KIAA1191 Blocking Peptide

  • Catalog number
    33R-9155
  • Price
    Please ask
  • Size
    100 µg
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Neuroscience
  • Residues
    TKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWF
  • Type of protein
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • URL
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
  • Gene symbol
    KIAA1191
  • Short name
    KIAA1191 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative name
    A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA1191 antibody, catalog no. 70R-4448
  • Alternative technique
    control, peptides
Gene info
Similar products
Filters
+32-(0)1-658-90-45 [email protected]
Contact
Chat with gentaur.com employee