Recombinant Rabbit Apolipoprotein E(APOE)

#

• Catalog number
  RPC20548
• Price:

  Please ask

  Ask for price
• Size
  1 mg

# #

• Verified reactivity
  Oryctolagus cuniculus (Rabbit)
• Protein number
  P18287
• Gene number
  APOE
• Other name
  no alternative name
• Protein origin
  E.coli
• Protein region
  19-311aa
• Protein sequence
  QTEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
• Information about sequence
  Full Length
• Expected molecular weight
  52.52kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• About
  Rabbits are used for polyclonal antibody production by bioma. Rabbit antibodies are very stable and can be stored for several days at room temperature. bioma adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

#

• Gene target
  Apolipoprotein   APOE  
• Gene symbol
  APOE
• Short name
  Recombinant Rabbit Apolipoprotein E(APOE)
• Technique
  Recombinant, Rabbit, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  Rabbit, Rabbits
• Alternative name
  Rec. production species: rabbit Apolipoprotein E(apolipoprotein E)
• Alternative technique
  rec, rabbit-anti
• Alternative to gene target
  apolipoprotein E, AD2 and LDLCQ5 and LPG, APOE and IDBG-56807 and ENSG00000130203 and 348, lipoprotein particle binding, nuclei, Apoe and IDBG-152108 and ENSMUSG00000002985 and 11816, APOE and IDBG-639311 and ENSBTAG00000010123 and 281004

Gene info

• Identity
  HGNC:613
• Gene
  APOE
• Long gene name
  apolipoprotein E
• Synonyms gene
  • AD2
• Synonyms gene name
  • Alzheimer disease 2 (APOE*E4-associated, late onset)
• GenBank acession
  • K00396
• Locus
  19q13.32
• Discovery year
  2001-06-22
• Entrez gene record
  348
• Pubmed identfication
  • 10662539
• RefSeq identity
  • NM_000041
• Classification
  • Apolipoproteins
• VEGA ID
  OTTHUMG00000128901
• Locus Specific Databases
  • ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products