Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse Interleukin 1ß IL-1ß

Recombinant Mouse Interleukin 1ß IL-1ß is available 4 times from Novo labs

C042-50 | Recombinant Mouse Interleukin-1ß/IL-1ß size: 50 ug | 592.52 USD

Catalog number C042-50
Supplier novo
Price 592.52 USD
Size 50 ug
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity 5990
Gene IL19
Long gene name interleukin 19
Synonyms
  • IL-19
  • MDA1
  • ZMDA1
  • IL-10C
  • NG.1
Synonyms name
  • melanoma differentiation associated protein-like protein
GenBank acession
  • AF192498
Locus 1q32.1
Discovery year 2000-03-29
Entrez gene record 29949
Pubmed identfication
  • 11196675
RefSeq identity
  • NM_153758
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000036387
2. Gene info
Identity 5991
Gene IL1A
Long gene name interleukin 1 alpha
Synonyms gene
  • IL1
Synonyms
  • IL1F1
  • IL-1A
  • IL1-ALPHA
Synonyms name
  • preinterleukin 1 alpha
  • hematopoietin-1
  • pro-interleukin-1-alpha
GenBank acession
  • M28983
Locus 2q14.1
Discovery year 2001-06-22
Entrez gene record 3552
Pubmed identfication
  • 8188271
  • 2989698
RefSeq identity
  • NM_000575
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000131315
3. Gene info
Identity 15741
Gene IL36G
Long gene name interleukin 36 gamma
Synonyms gene
  • IL1F9
Synonyms gene name
  • interleukin 1 family, member 9
Synonyms
  • IL-1H1
  • IL-1RP2
  • IL-1F9
  • IL1H1
  • IL1E
Synonyms name
  • interleukin-1 homolog 1
  • interleukin 1-related protein 2
  • interleukin-1 epsilon
GenBank acession
  • AF200492
Locus 2q14.1
Discovery year 2002-08-02
Entrez gene record 56300
Pubmed identfication
  • 10860666
  • 10744718
  • 11991722
  • 11991723
RefSeq identity
  • NM_019618
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000131336
Product images
    #Mouse#.jpg

C042-500 | Recombinant Mouse Interleukin-1ß/IL-1ß size: 500 ug | 1,306.65 USD

Loading

C042-1000 | Recombinant Mouse Interleukin-1ß/IL-1ß size: 1 mg | 1,839.56 USD

Loading

C042-10 | Recombinant Mouse Interleukin-1ß/IL-1ß size: 10 ug | 242.02 USD

Loading
Description Recombinant Mouse Interleukin-1 beta is produced by our E.coli expression system and the target gene encoding Val118-Ser269 is expressed.
Species reactivity Mouse
Origin Escherichia coli
Peptide sequence VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS
Estimated molecular weight 17,4 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 50mM TrisHCl, 50mM NaCl, pH 8.0.
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number P10749
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin name Mus musculus
Source Recombinants or rec. proteins
Group recombinants
Gene targetInterleukin-1ß/IL-1ß
Short name Recombinant Mouse Interleukin-1ß/IL-1ß
Technique Recombinant, Mouse
Host mouse
Species Mouses
Alternative name Mouse IL-1 beta/IL-1F2/IL-1b
Alternative technique rec
Similar products
cAMP ELISA Kit| General Cyclic adenosine monophosphate ELISA Kit Suppplier: Lifescience Market
Price: 821.43 USD
Assay kit for Guinea pig Kidney Injury Molecule 1 ELISA Suppplier: BlueGen ELISAs
Price: 721.28 USD
FAM76B 3 UTR Lenti reporter Suppplier: ABM microrna
Price: 566.30 USD
APC-Linked Monoclonal Antibody to Integrin Alpha 2 (ITGa2) Suppplier: MyBioSource
Price: 500.72 USD
MPEG1 Rabbit Polyclonal Suppplier: MyBioSource
Price: 481.65 USD
pCMV-SPORT6-CHST9 Plasmid Suppplier: Lifescience Market
Price: 387.47 USD
Recombinant Mouse Interleukin 23 IL-23 Suppplier: novo
Price: 277.78 USD
Angiotensin I Converting Enzyme 2 ACE2 Polyclonal Antibody Rat Suppplier: Cloud Clone Corp
Price: 257.52 USD
Recombinant Mouse Interleukin 1a IL-1a Suppplier: novo
Price: 242.02 USD
Recombinant Mouse Interleukin 6 IL-6 Suppplier: novo
Price: 242.02 USD
Recombinant Mouse Interleukin 10 IL-10 Suppplier: novo
Price: 242.02 USD
Recombinant Mouse Interleukin 16 IL-16 Suppplier: novo
Price: 187.18 USD
Multi-drug 12 drugs Test Cassette Suppplier: AllTests
Price: 147.83 USD
3 Fluoro 4 formylphenylboronic acid Suppplier: trca
Price: 128.76 USD
Recombinant Mouse Interleukin 16 Suppplier: MyBioSource
Price: 5.96 USD
Mouse Ubiquitin ELISA Kit Suppplier: MyBioSource
Price: 5.96 USD
Recombinant Zymomonas mobilis Elongation factor Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Mouse Interleukin-1ß/IL-1ß | Technique alternati
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Interleukin-1ß/IL-1ß
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee