Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Equine IL-1

Recombinant Equine IL-1 is available 8 times from Kingfisherbiotech labs

RP0358E-100 | Recombinant Equine IL-1 alpha size: 100 ug | 1,091.88 USD

Loading

RP0358E-025 | Recombinant Equine IL-1 alpha size: 25 ug | 485.28 USD

Catalog number RP0358E-025
Price 485.28 USD
Size 25 ug
Target IL-1 alpha
Alias' IL-1F1
MW 18.1 kDa
Entrez Gene ID 100064969
Protein Sequence SVHYNFQSNTKYNFMRIVNHQCTLNDALNQSVIRDTSGQYLATAALNNLDDAVKFDMGAYTSEEDSQLPVTLRISKTRLFVSAQNEDEPVLLKEMPDTPKTIKDETNLLFFWERHGSKNYFKSVAHPKLFIATKQGKLVHMARGQPSITDFQILDNQF (158)
Description The Recombinant Equine IL-1 alpha is a α- or alpha protein sometimes glycoprotein present in blood.
Gene The Interleukin-1 family (IL-1 family) is a group of 11 cytokines, which plays a central role in the regulation of immune and inflammatory responses to infections or sterile insults. Rec. E. coli interleukin-1 for cell culture or antibody production.
Additional source Recombinants or rec. proteins
Group recombinants
Gene targetEquine IL-1 alpha
Short name Recombinant Equine IL-1 alpha
Alternative name recombinant horse Interleukin-1 a
1. Gene info
Identity 5990
Gene IL19
Long gene name interleukin 19
Synonyms
  • IL-19
  • MDA1
  • ZMDA1
  • IL-10C
  • NG.1
Synonyms name
  • melanoma differentiation associated protein-like protein
GenBank acession
  • AF192498
Locus 1q32.1
Discovery year 2000-03-29
Entrez gene record 29949
Pubmed identfication
  • 11196675
RefSeq identity
  • NM_153758
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000036387
2. Gene info
Identity 5991
Gene IL1A
Long gene name interleukin 1 alpha
Synonyms gene
  • IL1
Synonyms
  • IL1F1
  • IL-1A
  • IL1-ALPHA
Synonyms name
  • preinterleukin 1 alpha
  • hematopoietin-1
  • pro-interleukin-1-alpha
GenBank acession
  • M28983
Locus 2q14.1
Discovery year 2001-06-22
Entrez gene record 3552
Pubmed identfication
  • 8188271
  • 2989698
RefSeq identity
  • NM_000575
Classification
  • Interleukins
Havana BLAST/BLAT OTTHUMG00000131315

RP0358E-005 | Recombinant Equine IL-1 alpha size: 5 ug | 363.96 USD

Loading

RP0060E-005 | Recombinant Equine IL-1 beta size: 5 ug | 363.96 USD

Loading

RP0060E-025 | Recombinant Equine IL-1 beta size: 25 ug | 485.28 USD

Loading

RP0060E-100 | Recombinant Equine IL-1 beta size: 100 ug | 1,091.88 USD

Loading

RP0428E-025 | Recombinant Equine IL-1 Receptor Antagonist size: 25 ug | 485.28 USD

Loading

RP0428E-005 | Recombinant Equine IL-1 Receptor Antagonist size: 5 ug | 363.96 USD

Loading
Product Type Protein
Form Lyophilized
Storage -20 °C
Shipping Ambient
Source Yeast
Technique Recombinant
Species Equine
Alternative technique rec
Similar products
Plant Cationic Amino Acid Transporter ELISA Kit Suppplier: MyBioSource
Price: 644.21 USD
Recombinant Equine IL-13 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-8 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-10 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-6 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-15 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-4 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-5 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-2 Suppplier: kingfisherbiotech
Price: 363.96 USD
Recombinant Equine IL-10 Suppplier: Immunochemistry kits
Price: 266.90 USD
Recombinant Equine IL-4 Suppplier: Immunochemistry kits
Price: 266.90 USD
Recombinant Equine IL-15 Suppplier: Immunochemistry kits
Price: 266.90 USD
Recombinant Equine IL-6 Suppplier: Immunochemistry kits
Price: 266.90 USD
Recombinant Equine IL-2 Suppplier: Immunochemistry kits
Price: 266.90 USD
Recombinant Equine IL-8 Suppplier: Immunochemistry kits
Price: 266.90 USD
Recombinant Equine IL-13 Suppplier: Immunochemistry kits
Price: 266.90 USD
Recombinant Equine IL-5 Suppplier: Immunochemistry kits
Price: 266.90 USD
Ask
Ajax processing
Close
Recombinant Equine IL-1 alpha | Technique alternative | 0101
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Equine
  • IL-1
  • alpha
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee