Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse Interleukin 1 family member 10 Il1f10

Recombinant Mouse Interleukin 1 family member 10 Il1f10 is available 6 times from Bioma labs

RPC20459 | Recombinant Mouse Interleukin-1 family member 10(Il1f10) size: 500 μg | 1,189.03 USD

Loading

RPC20459 | Recombinant Mouse Interleukin-1 family member 10(Il1f10) size: 100 μg | 355.17 USD

Loading

RPC20459 | Recombinant Mouse Interleukin-1 family member 10(Il1f10) size: 200 μg | 523.93 USD

Catalog number RPC20459
Supplier bioma
Price 523.93 USD
Size 200 μg
Expected molecular weight 32.87kD
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Mouse#.jpg

RPC20459 | Recombinant Mouse Interleukin-1 family member 10(Il1f10) size: 50 μg | 247.07 USD

Loading

RPC20459 | Recombinant Mouse Interleukin-1 family member 10(Il1f10) size: 1 mg | 1,184.62 USD

Loading

RPC20459 | Recombinant Mouse Interleukin-1 family member 10(Il1f10) size: 10 μg | 182.00 USD

Loading
Other name no alternative name
Protein origin E.coli
Estimated production time 7-11 business days
Gene number Il1f10
Gene name Il1f10
Protein number Q8R459
Protein sequence MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
Notes For research use only. Not for diagnostic procedures.
Use before 1 year
Information about sequence Full Length
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Shipping requirements Blue ice
Verified reactivity Mus musculus (Mouse)
Protein purity ≥ 90%
Protein region 1-152aa
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin name Mus musculus
Source Recombinants or rec. proteins
Group recombinants
Gene targetInterleukin-1 family member 10(Il1f10
Short name Recombinant Mouse Interleukin-1 family member 10(Il1f10)
Technique Recombinant, Mouse
Host mouse
Species Mouse
Alternative name recombinant Mouse Interleukin-1 family member 10(interleukin 1 family, member 10 (theta))
Alternative technique rec
Alternative to gene target interleukin 1 family, member 10 (theta), IL1F10 and IDBG-66783 and ENSG00000136697 and 84639, interleukin-1 receptor binding, Extracellular, Il1f10 and IDBG-142314 and ENSMUSG00000046845 and 215274, BT.106467 and IDBG-634664 and ENSBTAG00000018012 and 615702
Similar products
Recombinant Mouse Interleukin 1 family member 10 Suppplier: MyBioSource
Price: 189.72 USD
Recombinant Mouse NLR family member X1 (Nlrx1), partial Suppplier: MyBioSource
Price: 1 597.14 USD
Recombinant Mouse Golgin subfamily A member Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Mouse C type lectin domain family 2 member Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Mouse C type lectin domain family 1 member Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Mouse Interleukin-1 family member 10(Il1f10) siz
Filters
+32-(0)1-658-90-45 [email protected]
  • Interleukin-1
  • family
  • member
  • 10(Il1f10
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee