Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

IL-17A F human recombinant

IL-17A F human recombinant is available 3 times from Biovision labs

4176AF-1000 | IL-17A/F, human recombinant size: 1 mg | 8,921.80 USD

Loading

4176AF-10 | IL-17A/F, human recombinant size: 10 ug | 454.72 USD

Loading

4176AF-50 | IL-17A/F, human recombinant size: 50 ug | 1,405.16 USD

Loading
Synonyms IL17A/F, IL17 A/F, IL-17A/F Interleukin-17 A/F, Interleukin-17 AF
Alternative_names IL17A/F, IL17 A/F, IL-17A/F Interleukin-17 A/F, Interleukin-17 AF, Cytotoxic T-lymphocyte-associated antigen 8
Description A proinflammatory cytokine produced by activated T cells
Recombinant Yes
Source E. coli
Purity by SDS-PAGE ≥98%
Assay SDS-PAGE
Molecular Weight 30.7 kDa
Storage Temp. -20°C
Shipping Gel pack
Shelf Life 12 months
Appearance Lyophilized protein
Physical form description Lyophilized with no additives
Reconstitution Instructions Centrifuge the vial prior to opening. Reconstitute with sterile H₂O to a concentration not more than 1 mg/ml; This solution can then be diluted into other aqueous buffers.
Background Information Human IL-17A/F is a 40 kDa glycoprotein which is secreted as a disulfide-linked heterodimer. IL-17A/F consists of two proteins, IL-17A and IL17F. Human IL17A is produced as a 155 a.a precursor that includes a 23 amino acids signal sequence and a 132 amino acid chain that includes an N-linked glycosylation site. Human IL17F is produced as a 153 amino acid precursor with a 20 amino acid signal sequence and a 133 amino acid region and an N-linked glycosylation site. Both proteins (IL17A & IL17F) share 50 % amino acid sequence identity. Human IL17A & IL17F show approximately 60 % homology in their amino acid sequence to mouse IL-17A and IL-17F. Interleukin-17A/F and IL17A, IL17F homodimers are manufactured by activted CD4+ T cells, called Th17. IL-23 causes Th17 lymphocytes to manufacture IL-17A/F. Interleukin-17A/F induces chemokine production and airway neutrophilia with intermediate potency between IL17A (most potent) and IL17F (least potent). IL-17A/F Human Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide chain containing 1 monomeric subunit of each IL-17A & IL-17F. The active dimer contains 271 amino acids and having a total molecular mass of 30.7 kDa. The IL-17A/F Human is purified by proprietary chromatographic techniques.
Amino acid sequence MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Handling Centrifuge the vial prior to opening.
Usage For Research Use Only! Not to be used in humans
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Additional source Recombinants or rec. proteins
Group recombinants
Gene targetIL-17A/F
Short name IL-17A/F, recombinant
Technique Recombinant
Species Human
Alternative name Interleukin-17A/F, H. sapiens recombinant
Alternative technique rec
Similar products
UPF3B shRNA Plasmid (Human) Suppplier: MyBioSource
Price: 769.15 USD
ARTS1 Antibody (Center) Suppplier: Leading Biology
Price: 765.59 USD
CG B core fragment antibody Suppplier: genways
Price: 632.44 USD
4 Hydroxy 1 3 pyridyl 1 butanone HPB Suppplier: MyBioSource
Price: 605.10 USD
LYSMD4 siRNA (Human) Suppplier: MyBioSource
Price: 538.53 USD
JIP3/Syd2/JSAP1 Polyclonal Antibody Suppplier: bioma
Price: 529.02 USD
SMARCD1 Polyclonal Primary Antibody Suppplier: EnoGene
Price: 445.80 USD
IL-17A human recombinant Suppplier: Biovision
Price: 269.26 USD
Human CTSC CRISPR Knock Out Cell Line Suppplier: ABM CrispR
Price: 6 920.00 USD
Monkey Collagen Type XI Alpha 1 ELISA Kit Suppplier: MyBioSource
Price: 5.94 USD
IL-17A human recombinant Suppplier: MyBioSource
Price: 5.94 USD
IL-17A F human recombinant Suppplier: MyBioSource
Price: 5.94 USD
Ataxin 1 Antibody ATTO 700 Suppplier: MyBioSource
Price: 5.94 USD
Rat Deiodinase Iodothyronine Type ELISA Kit Suppplier: Reddot Biotech
Price: 1 006.91 USD
Caenorhabditis elegans Dual oxidase 1 bli 3 partial Suppplier: MBS Recombinant
Price: 1 865.23 USD
Ask
Ajax processing
Close
IL-17A F human recombinant - Gentaur.com
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • IL-17A/F
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee