Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Helicobacter

Recombinant Helicobacter is available 23 times from Bioma labs

RPC20384 | Recombinant Helicobacter pylor DNA protection during starvation protein(dps) size: 1 mg | 1,900.89 USD

Catalog number RPC20384
Supplier bioma
Price 1,900.89 USD
Size 1 mg
Verified reactivity Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Protein number P43313 
Gene number dps
Other name Bacterioferritin; HP-NAP; Neutrophil-activating protein A; Short name:NAP A
Protein region 1-144aa
Protein sequence MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Information about sequence Full Length
Expected molecular weight 31.84kDa
Additional disease Helicobacter pillory antibodies and ELISA kits as diagnostic to detect Gram-negative helicobacter bacteria genus name Helicobacter.
Source Recombinants or rec. proteins
Group recombinants
Gene targetHelicobacter pylor DNA protection during starvation protein(dps
Short name Recombinant Helicobacter pylor DNA protection during starvation protein(dps)
Technique Recombinant, dna
Label N-terminal 6xHis-SUMO-tagged
Alternative name recombinant Helicobacter pylor Desoxyribonucleic acid protection during starvation protein(dps)
1. Gene info
Identity 9413
Gene PRKDC
Long gene name protein kinase, DNA-activated, catalytic subunit
Synonyms gene
  • HYRC
  • HYRC1
Synonyms gene name
  • protein kinase, DNA-activated, catalytic polypeptide
Synonyms
  • DNPK1
  • p350
  • DNAPK
  • XRCC7
  • DNA-PKcs
  • DNAPKc
  • DNA-PKC
  • p460
Synonyms name
  • DNA-dependent protein kinase catalytic subunit
Locus 8q11.21
Discovery year 1993-11-09
Entrez gene record 5591
Pubmed identfication
  • 7638222
RefSeq identity
  • NM_001081640
Classification
  • Armadillo like helical domain containing
Havana BLAST/BLAT OTTHUMG00000164239
Locus Specific Databases
  • LRG_162

RPC20384 | Recombinant Helicobacter pylor DNA protection during starvation protein(dps) size: 200 μg | 827.40 USD

Loading

RPC20384 | Recombinant Helicobacter pylor DNA protection during starvation protein(dps) size: 100 μg | 550.41 USD

Loading

RPC20384 | Recombinant Helicobacter pylor DNA protection during starvation protein(dps) size: 50 μg | 372.09 USD

Loading

RPC20384 | Recombinant Helicobacter pylor DNA protection during starvation protein(dps) size: 10 μg | 196.15 USD

Loading

RPC20295 | Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial size: 200 μg | 685.94 USD

Loading

RPC20295 | Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial size: 100 μg | 461.25 USD

Loading

RPC20295 | Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial size: 10 μg | 196.15 USD

Loading

RPC20295 | Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial size: 50 μg | 315.03 USD

Loading

RPC20295 | Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial size: 500 μg | 1,281.53 USD

Loading

RPC20295 | Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial size: 1 mg | 1,560.89 USD

Loading

RPC20329 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 500 μg | 1,281.53 USD

Loading

RPC20205 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 50 μg | 372.09 USD

Loading

RPC20329 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 100 μg | 784.61 USD

Loading

RPC20205 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 200 μg | 827.40 USD

Loading

RPC20329 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 200 μg | 1,193.56 USD

Loading

RPC20205 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 10 μg | 196.15 USD

Loading

RPC20329 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 1 mg | 2,768.72 USD

Loading

RPC20205 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 1 mg | 1,900.89 USD

Loading

RPC20329 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 10 μg | 261.54 USD

Loading

RPC20205 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 100 μg | 550.41 USD

Loading

RPC20205 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 500 μg | 1,059.22 USD

Loading

RPC20329 | Recombinant Helicobacter pylori Vacuolating cytotoxin autotransporter(vacA),partial size: 50 μg | 521.88 USD

Loading
Protein origin E.coli
Protein purity ≥ 90%
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Use before 1 year
Shipping requirements Blue ice
Estimated production time 7-11 business days
Notes For research use only. Not for diagnostic procedures.
Species Helicobacter
Alternative technique rec
Disease helicobacter
Similar products
Guinea pig Core ELISA kit Suppplier: BlueGen ELISAs
Price: 858.31 USD
Canine ADP-ribosylation factor 3 (ARF3) ELISA Kit Suppplier: MyBioSource
Price: 676.43 USD
HT-2 Toxin Suppplier: MyBioSource
Price: 676.43 USD
GOSR1 antibody Suppplier: genways
Price: 619.36 USD
DDX23 Primary Antibody Suppplier: EnoGene
Price: 481.46 USD
pPLK/GFP+Puro-MMP9 shRNA-1 Plasmid Suppplier: Lifescience Market
Price: 423.21 USD
3 Furan 2 yl acrylic acid Suppplier: ChemScene
Price: 359.02 USD
Hepatocyte Promoting Growth Factor Suppplier: Abbexa
Price: 300.77 USD
Escherichia coli Deoxyribose operon repressor deoR Suppplier: MBS Recombinant
Price: 2 075.64 USD
Rat Janus Kinase ELISA Kit Suppplier: Biomatik
Price: 1 126.98 USD
Fignl1 3 UTR GFP Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Fish Neugrin ELISA Kit Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Helicobacter pylor DNA protection during starvat
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Helicobacter
  • pylor
  • DNA
  • protection
  • during
  • starvation
  • protein(dps
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee