Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human Tumor necrosis factor receptor superfamily member 25 TNFRSF25 partial

Recombinant Human Tumor necrosis factor receptor superfamily member 25 TNFRSF25 partial is available 6 times from Bioma labs

RPC20412 | Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial size: 10 μg | 191.96 USD

Loading

RPC20412 | Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial size: 200 μg | 809.73 USD

Loading

RPC20412 | Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial size: 50 μg | 364.14 USD

Loading

RPC20412 | Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial size: 500 μg | 1,254.15 USD

Loading

RPC20412 | Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial size: 100 μg | 538.65 USD

Loading

RPC20412 | Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial size: 1 mg | 1,860.28 USD

Loading
Verified reactivity Homo sapiens (Human)
Protein number Q93038
Gene name TNFRSF25
Other name Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; Lymphocyte-associated receptor of death; Short name:LARD
Protein origin E.coli
Protein region 25-199aa
Protein sequence QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Information about sequence Extracellular Domain
Protein purity ≥ 90%
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Use before 1 year
Shipping requirements Blue ice
Estimated production time 7-11 business days
Notes For research use only. Not for diagnostic procedures.
Gene number TNFRSF25
Description Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetTumor necrosis factor receptor superfamily member 25(TNFRSF25),partial
Short name Recombinant Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial
Technique Recombinant
Label N-terminal 6xHis-tagged
Species Human
Alternative name recombinant H. sapiens Tumor necrosis factor receptor supergroup member 25(tumor necrosis factor receptor superfamily, member 25),partial
Alternative technique rec
Alternative to gene target tumor necrosis factor receptor superfamily, member 25, APO-3 and DDR3 and DR3 and LARD and TNFRSF12 and TR3 and TRAMP and WSL-1 and WSL-LR, TNFRSF25 and IDBG-227097 and ENSG00000215788 and 8718, protein binding, Extracellular, Tnfrsf25 and IDBG-206339 and ENSMUSG00000024793 and 85030, BT.30010 and IDBG-633838 and ENSBTAG00000006519 and 783432
Tissue tumor
Similar products
Pig MYO(Myoglobin) ELISA Kit Suppplier: ELK Biotech
Price: 858.59 USD
anti-MGO-modified proteins Antibody, 0,1 mg Suppplier: acr
Price: 716.65 USD
GOAT ANTI SNAP-25 (C-TERMINAL) Antibody Suppplier: MBS Polyclonals
Price: 707.35 USD
Assay kit for Canine Carbohydrate ELISA Suppplier: BlueGen ELISAs
Price: 703.86 USD
TAZ-HA Adenovirus (Human) Suppplier: abm Adinovirus
Price: 501.43 USD
Anti-CDC25C Antibody Suppplier: aviva
Price: 493.28 USD
Anti-cIAP2 Picoband Antibody Suppplier: boster
Price: 453.73 USD
c FOS pS32 Blocking Peptide Suppplier: abbex
Price: 432.78 USD
Human Symmetric ELISA Kit Suppplier: MyBioSource
Price: 411.84 USD
Mouse antibody to or anti Human CD11c Suppplier: genways
Price: 364.14 USD
CD8a Antibody Suppplier: NJS poly
Price: 204.76 USD
mmu miR 7230 3p Suppplier: ABM microrna
Price: 195.45 USD
GCY 3'UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 2 531.56 USD
Recombinant Borrelia Hermsii rpsF Protein (aa 1-131) Suppplier: Creative Biolabs
Price: 1 270.43 USD
Streptomyces coelicolor Oligoribonuclease orn Suppplier: MBS Recombinant
Price: 1 877.73 USD
Ask
Ajax processing
Close
Recombinant Human Tumor necrosis factor receptor superfamily
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Tumor
  • necrosis
  • factor
  • receptor
  • superfamily
  • member
  • 25(TNFRSF25),partial
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee