Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

RTN1 Blocking Peptide

RTN1 Blocking Peptide is available 4 times from Fitzgerald labs

33R-2384 | RTN1 Blocking Peptide size: 100 ug | 308.84 USD

Loading

33R-2384 | RTN1 Blocking Peptide size: 100 µg | 231.63 USD

Loading

33R-5805 | RTN1 Blocking Peptide size: 100 µg | 231.63 USD

Loading

33R-5805 | RTN1 Blocking Peptide size: 100 ug | 308.84 USD

Catalog number 33R-5805
Supplier fitzgerald
Price 308.84 USD
Size 100 ug
Tag/Conjugate MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
1. Gene info
Identity 10467
Gene RTN1
Long gene name reticulon 1
Synonyms gene
  • NSP
Synonyms gene name
  • neuroendocrine-specific protein
GenBank acession
  • L10333
Locus 14q23.1
Discovery year 1993-08-24
Entrez gene record 6252
Pubmed identfication
  • 8275708
Havana BLAST/BLAT OTTHUMG00000028947
2. Gene info
Identity 8018
Gene NSP
Long gene name reticulon 1
Synonyms gene name
  • neuroendocrine-specific protein
Synonyms
  • RTN1
GenBank acession
  • L10333
Locus 14q23.1
Discovery year 1993-08-24
Entrez gene record 6252
Pubmed identfication
  • 8275708
Havana BLAST/BLAT OTTHUMG00000028947
Category Proteins
Applications WB, IHC
Tested for WB; IHC
Research Area Neuroscience
Type of protein Synthetic
Product Subtype Blocking Peptides
Type1 Synthetic
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Antibody Subtype Blocking Peptides
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Shipping Info Blue Ice
Area of research Neuroscience
Shipping conditions Blue Ice
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetRTN1
Short name RTN1 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name RTN1 inhibiting short protein sequence
Alternative technique control
Similar products
Ask
Ajax processing
Close
RTN1 Blocking Peptide sku: 2011957817 - Gentaur.com
Filters
+32-(0)1-658-90-45 [email protected]
  • RTN1
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee