Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse Noggin NOG C 6His

Recombinant Mouse Noggin NOG C 6His is available 4 times from Novo labs

C028-500 | Recombinant Mouse Noggin/NOG (C-6His) size: 500 ug | 1,507.35 USD

Loading

C028-10 | Recombinant Mouse Noggin/NOG (C-6His) size: 10 ug | 161.06 USD

Loading

C028-50 | Recombinant Mouse Noggin/NOG (C-6His) size: 50 ug | 344.80 USD

Loading

C028-1000 | Recombinant Mouse Noggin/NOG (C-6His) size: 1 mg | 2,128.89 USD

Catalog number C028-1000
Supplier novo
Price 2,128.89 USD
Size 1 mg
Origin Human Cells
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity 7866
Gene NOG
Long gene name noggin
Synonyms gene
  • SYNS1
  • SYM1
Synonyms gene name
  • synostoses (multiple) syndrome 1
  • symphalangism 1 (proximal)
GenBank acession
  • U31202
Locus 17q22
Discovery year 1999-03-24
Entrez gene record 9241
Pubmed identfication
  • 7666191
  • 10080184
  • 11545688
RefSeq identity
  • NM_005450
Havana BLAST/BLAT OTTHUMG00000151770
Product images
    #Mouse#.jpg
Description Recombinant Mouse Noggin is produced by our Mammalian expression system and the target gene encoding Gln28-Cys232 is expressed with a 6His tag at the C-terminus.
Species reactivity Mouse
Peptide sequence QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSCHHHHHH
Estimated molecular weight 23,9 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number P97466
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin name Mus musculus
Source Recombinants or rec. proteins
Group recombinants
Gene targetNoggin/NOG C-6His
Short name Recombinant Mouse Noggin/NOG (C-6His)
Technique Recombinant, Mouse
Host mouse
Species Mouse
Alternative name Recombinant Mouse Noggin (C-6His)
Alternative technique rec
Alternative to gene target noggin, SYM1 and SYNS1, NOG and IDBG-60160 and ENSG00000183691 and 9241, protein homodimerization activity, Extracellular, Nog and IDBG-208239 and ENSMUSG00000048616 and 18121, NOG and IDBG-647068 and ENSBTAG00000040282 and 538769
Similar products
Human Syntenin 2 ST2 ELISA Kit Suppplier: Dldevelop
Price: 683.92 USD
Recombinant Mouse FOLR1 / FR-alpha Protein (His tag) Suppplier: MyBioSource
Price: 652.17 USD
Human Keratin, type II cytoskeletal 6B, KRT6B ELISA Kit Suppplier: MyBioSource
Price: 602.26 USD
Putative homeobox protein Human ELISA Kit Suppplier: Glorybioscience
Price: 538.75 USD
ELISA kit for Human prothrombin Suppplier: Pariselements
Price: 466.16 USD
Mouse Monoclonal Primary Antibody to ARFGAP1 Suppplier: EnoGene
Price: 425.33 USD
OR4A4 47 Polyclonal Antibody Suppplier: Biomatik
Price: 418.52 USD
TmpB T pallidum Nichols strain Suppplier: Immune Technology
Price: 395.84 USD
CLEC12A antibody Suppplier: MyBioSource
Price: 376.55 USD
TRH Peptide Suppplier: abbex
Price: 286.95 USD
TAB2 Peptide Suppplier: Zyagen
Price: 231.38 USD
Thiamethoxam-d3 Suppplier: trca
Price: 188.28 USD
EFCAB8 Lentiviral Vector Human pLenti GIII Suppplier: ABM lentivectors
Price: 3 070.51 USD
Recombinant Black beetle virus Suppplier: MyBioSource
Price: 0.00 USD
TMEM106A cDNA Clone Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Mouse Noggin/NOG (C-6His) | Technique alternativ
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Noggin/NOG
  • C-6His
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee