Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse Noggin NOG C 6His

Recombinant Mouse Noggin NOG C 6His is available 4 times from Novo labs

C028-50 | Recombinant Mouse Noggin/NOG (C-6His) size: 50 ug | 336.71 USD

Loading

C028-1000 | Recombinant Mouse Noggin/NOG (C-6His) size: 1 mg | 2,078.97 USD

Catalog number C028-1000
Supplier novo
Price 2,078.97 USD
Size 1 mg
Origin Human Cells
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity7866
GeneNOG
Long gene namenoggin
Synonyms gene
Synonyms gene name
  • synostoses (multiple) syndrome 1
  • symphalangism 1 (proximal)
GenBank acession
Locus17q22
Discovery year1999-03-24
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000151770
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Mouse#.jpg

C028-500 | Recombinant Mouse Noggin/NOG (C-6His) size: 500 ug | 1,472.00 USD

Loading

C028-10 | Recombinant Mouse Noggin/NOG (C-6His) size: 10 ug | 157.28 USD

Loading
Description Recombinant Mouse Noggin is produced by our Mammalian expression system and the target gene encoding Gln28-Cys232 is expressed with a 6His tag at the C-terminus.
Peptide sequence QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSCHHHHHH
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Estimated molecular weight 23,9 kDa
Package form Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Species reactivity Mouse
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number P97466
Shipping condition Ambient/Room Temperature
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin name Mus musculus
Source Recombinants or rec. proteins
Group recombinants
Gene targetNoggin/NOG C-6His
Short name Recombinant Mouse Noggin/NOG (C-6His)
Technique Recombinant, Mouse
Host mouse
Species Mouse
Alternative name recombinant Mouse Noggin/noggin (C-6His)
Alternative technique rec
Alternative to gene target noggin, SYM1 and SYNS1, NOG and IDBG-60160 and ENSG00000183691 and 9241, protein homodimerization activity, Extracellular, Nog and IDBG-208239 and ENSMUSG00000048616 and 18121, NOG and IDBG-647068 and ENSBTAG00000040282 and 538769
Similar products
Recombinant Mouse Homeobox protein NANOG (Nanog) Suppplier: MyBioSource
Price: 924.85 USD
Recombinant Mouse RANK TNFRSF11A C 6His Suppplier: novo
Price: 336.71 USD
Recombinant mouse Murinoglobulin 1 Suppplier: SAB
Price: 305.70 USD
Recombinant Mouse Exostosin Like 2 EXTL2 N 6His Suppplier: novo
Price: 173.89 USD
Recombinant Mouse Collagen 1 Chain C 6His Suppplier: novo
Price: 157.28 USD
Recombinant Mouse S100A11 N 6His Suppplier: novo
Price: 111.87 USD
Recombinant Mouse Fibrinogen Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Mouse Immunoglobulin binding protein Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Noggin NOG Suppplier: Biomatik
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Mouse Noggin/NOG (C-6His) size: 1 mg
Filters
+32-(0)1-658-90-45 [email protected]
  • Noggin/NOG
  • C-6His
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee