Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

PLEKHG2 Blocking Peptide

PLEKHG2 Blocking Peptide is available 2 times from Fitzgerald labs

33R-2069 | PLEKHG2 Blocking Peptide size: 100 ug | 312.51 USD

Catalog number 33R-2069
Supplier fitzgerald
Price 312.51 USD
Size 100 ug
1. Gene info
Identity29515
Synonyms gene name
  • pleckstrin homology domain containing, family G (with RhoGef domain) member 2
GenBank acession
Locus19q13.2
Discovery year2004-12-01
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000152570

33R-2069 | PLEKHG2 Blocking Peptide size: 100 µg | 234.38 USD

Loading
Residues DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS
Category Proteins
Tested for WB; IHC
Product Subtype Blocking Peptides
Type1 Synthetic
Antibody Subtype Blocking Peptides
Shipping Info Blue Ice
Shipping conditions Blue Ice
Applications WB, IHC
Research Area Cell Cycle & Cell Death
Type of protein Synthetic
Tag/Conjugate DLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIPAKAKQVLLENS
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Product Type Proteins
Area of research Cell Cycle & Cell Death
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetPLEKHG2
Short name PLEKHG2 Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative name pleckstrin homology domain containing, family G (including RhoGef domain) member 2 inhibiting short protein sequence
Alternative technique control
Alternative to gene target pleckstrin homology domain containing, family G (with RhoGef domain) member 2, PLEKHG2 and IDBG-50331 and ENSG00000090924 and 64857, Rho guanyl-nucleotide exchange factor activity, Cytoplasm, Plekhg2 and IDBG-163140 and ENSMUSG00000037552 and 101497, PLEKHG2 and IDBG-637565 and ENSBTAG00000004017 and 504530
Similar products
Ask
Ajax processing
Close
PLEKHG2 Blocking Peptide size: 100 ug - Gentaur.com
Filters
+32-(0)1-658-90-45 [email protected]
  • PLEKHG2
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee