Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse Stem Cell Factor SCF c Kit Ligand

Recombinant Mouse Stem Cell Factor SCF c Kit Ligand is available 3 times from Novo labs

C775-1000 | Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand size: 1 mg | 2,770.40 USD

Loading

C775-10 | Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand size: 10 ug | 226.22 USD

Loading

C775-500 | Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand size: 500 ug | 1,798.64 USD

Loading
Description Recombinant Mouse Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Lys26-Ala189 is expressed.
Species reactivity Mouse
Origin Escherichia coli
Peptide sequence MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Estimated molecular weight 18,4 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number P20826
Additional description For cells, cell lines and tissues in culture till half confluency.Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.Stem cell factors and stem cell growth factors will produce stem cells or be part of a transdifferentiation process to produce other cells. A cell can transdifferentiate by going back to the naive stem cell stadium or directly into the other cell, helped by the stem cell and transdifferentiationf actors. Stem cell growth factors or stem cell factors are mostly used to produce iPSCs or induced pluripotent stem cells by Jamaka or Thomson factors by using for example 5 Lenti-III-CMV viruses, expressing the Yamanaka iPSC factor set (Oct4, Sox2, Nanog and Lin28) + GFP positive control. Trans differentiation will omit the stem cell stadium but stem cell factors sill play an important role in trans differentiation strategies.
Latin name Mus musculus
Source Recombinants or rec. proteins
Group recombinants
Gene targetStem Factor/SCF/c-Kit Ligand
Short name Recombinant Mouse Stem Factor/SCF/c-Kit Ligand
Technique Recombinant, Mouse
Host mouse
Species Mouse
Alternative name recombinant Mouse progenitor cellular Factor/SCF/c-reagent Ligand
Alternative technique rec
Alternative to gene target v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, C-Kit and CD117 and PBT and SCFR, KIT and IDBG-18980 and ENSG00000157404 and 3815, transferase activity, Extracellular, Kit and IDBG-172083 and ENSMUSG00000005672 and 16590, KIT and IDBG-642326 and ENSBTAG00000002699 and 280832
Tissue cell, stem
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Mouse Stem Cell Factor SCF c Kit Ligand
Filters
+32-(0)1-658-90-45 [email protected]
  • Stem
  • Factor/SCF/c-Kit
  • Ligand
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee