Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse IL-15 Receptor Subunit a CD215 IL-15RA C Fc

Recombinant Mouse IL-15 Receptor Subunit a CD215 IL-15RA C Fc is available 4 times from Novo labs

CJ86-1000 | Recombinant Mouse IL-15 Receptor Subunit a/CD215/IL-15RA (C-Fc) size: 1 mg | 1,343.11 USD

Loading

CJ86-10 | Recombinant Mouse IL-15 Receptor Subunit a/CD215/IL-15RA (C-Fc) size: 10 ug | 121.55 USD

Loading

CJ86-500 | Recombinant Mouse IL-15 Receptor Subunit a/CD215/IL-15RA (C-Fc) size: 500 ug | 854.49 USD

Loading

CJ86-50 | Recombinant Mouse IL-15 Receptor Subunit a/CD215/IL-15RA (C-Fc) size: 50 ug | 188.95 USD

Loading
Description Recombinant Mouse Interleukin-15 receptor alpha is produced by our Mammalian expression system and the target gene encoding Gly33-Lys205 is expressed with a Fc tag at the C-terminus.
Species reactivity Mouse
Peptide sequence GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Estimated molecular weight 45,5 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number Q60819
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin name Mus musculus
Additional description The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
Source Recombinants or rec. proteins
Group recombinants
Gene targetIL-15 Receptor Subunit a/CD215/IL-15RA C-Fc
Short name Recombinant Mouse IL-15 Receptor Subunit a/CD215/IL-15RA (C-Fc)
Technique Recombinant, Mouse, FC
Host mouse
Species Mouse
Alternative name Mouse IL-15 R alpha/CD215/IL-15RA(C-Fc)
Alternative technique rec
Similar products
Recombinant Pyrococcus furiosus Prefoldin subunit Suppplier: MyBioSource
Price: 738.95 USD
ELISA Kit FOR Mouse Proteoglycan 4 (Prg4) Suppplier: eiaab elisas
Price: 731.73 USD
Anti- MBD3L1 Antibody Suppplier: MBS Polyclonals
Price: 725.71 USD
FBXO11-HA Adenovirus (Human) Suppplier: abm Adinovirus
Price: 701.64 USD
CXorf26 antibody Suppplier: fitzgerald
Price: 646.28 USD
GNB4 3 UTR Lenti reporter Suppplier: ABM microrna
Price: 571.66 USD
SLC44A5 cloning plasmid Suppplier: Cusabio
Price: 570.46 USD
4-Methoxybenzamidine hydrochloride Suppplier: Molekula
Price: 477.79 USD
Cyclin A1 Antibody Suppplier: EnoGene
Price: 355.03 USD
Methyl tert butoxycarbonyl leucinate Suppplier: ChemScene
Price: 309.30 USD
Active SIRT6 His tagged human recombinant Suppplier: Biovision
Price: 243.26 USD
Interleukin 1 Alpha IL1a Suppplier: MyBioSource
Price: 239.50 USD
2'-Hydroxy-5'-methoxybiphenyl-3-carboxylic acid Suppplier: trca
Price: 156.46 USD
TMEM130 3'UTR GFP Stable Cell Line Suppplier: ABM microrna
Price: 1 708.97 USD
Mouse Antithrombin (AT) ELISA Kit Suppplier: Reddot Biotech
Price: 1 018.16 USD
5 Amino 3 3.4 dichlorophenyl Suppplier: SFC
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Mouse IL-15 Receptor Subunit a CD215 IL-15RA C F
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • IL-15
  • Receptor
  • Subunit
  • a/CD215/IL-15RA
  • C-Fc
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee