Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

PLAC1L Blocking Peptide

PLAC1L Blocking Peptide is available 2 times from Fitzgerald labs

33R-10184 | PLAC1L Blocking Peptide size: 100 µg | 254.39 USD

Loading

33R-10184 | PLAC1L Blocking Peptide size: 100 ug | 339.19 USD

Loading
Category Proteins
Antibody Subtype Blocking Peptides
Area of research Differentiation & Development
Residues YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW
Type of protein Synthetic
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB; IHC
Product Type Proteins
Product Subtype Blocking Peptides
Research Area Differentiation & Development
Tag/Conjugate YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW
Type1 Synthetic
Applications WB, IHC
Shipping Info Blue Ice
Test You can block the antibody by the specific target amino acid sequence of peptide.
Properties blocking peptide
Description Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
Gene targetPLAC1L
Short name PLAC1L Blocking Peptide
Technique blocking peptide, Blocking, peptide
Alternative technique control
Similar products
SAMD5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) Suppplier: ABM lentivectors
Price: 726.84 USD
GRIN2A-HA Adenovirus (Human) Suppplier: abm Adinovirus
Price: 706.25 USD
LCOR antibody Suppplier: fitzgerald
Price: 575.42 USD
SERC2 antibody Suppplier: MyBioSource
Price: 556.03 USD
AURKA siRNA (Human) Suppplier: MyBioSource
Price: 548.76 USD
DAZ2 (C-term) Rabbit pAb Suppplier: EnoGene
Price: 454.28 USD
Human heterogeneous nuclear ribonucleoprotein hnRNP ELISA Kit Suppplier: BT-Laboratory
Price: 448.22 USD
Anti-ANKRD13D antibody Suppplier: Lifescience Market
Price: 430.05 USD
Recombinant Human FTH1 Protein Suppplier: MyBioSource
Price: 254.39 USD
Xenopus laevis Retinal homeobox protein Rx rax Suppplier: MBS Recombinant
Price: 2 336.79 USD
ACAN 3'UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 1 577.24 USD
Ephx4 3 UTR Luciferase Stable Cell Line Suppplier: ABM microrna
Price: 0.00 USD
Quinone Suppplier: SFC
Price: 0.00 USD
Ask
Ajax processing
Close
PLAC1L Blocking Peptide - Gentaur.com
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • PLAC1L
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee