Filters
SKU Product name Supplier Catalog no. Size Price
01010213367 Assay Diluent (Protein Free) Info genways bulk GWB-ZLSLDL bulk Ask Ask
01010234281 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) Info ABM lentivectors LV799415 1.0 µg DNA Ask Ask
01010351326 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) Info ABM lentivectors LV799413 1.0 µg DNA Ask Ask
01010486525 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) Info ABM lentivectors LV799416 1.0 µg DNA Ask Ask
01010539551 Lgalsl Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) Info ABM lentivectors LV799414 1.0 µg DNA Ask Ask
01010842188 Lgalsl Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) Info ABM lentivectors LV799417 1.0 µg DNA Ask Ask
01010874660 Lgalsl Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) Info ABM lentivectors LV799418 1.0 µg DNA Ask Ask
01011001879 LGALSL, 1-172aa, Human, His tag, E.coli, Recombinant Protein Info genways bulk GWB-ATG109 bulk Ask Ask
01011941007 LGALSL protein His tag Info fitzgerald 80R-2685 50 µg Ask Ask
01012611964 CalSlide-I Nano-Fluorescence Calibration Slide Info kapitalbio 410011 1 slide Ask Ask
01012611965 CalSlide-II Nano-Fluorescence Calibration Slide Info kapitalbio 410012 1 slide Ask Ask
01012611966 CalSlide-III Nano-Fluorescence Calibration Slide Info kapitalbio 410014 1 slide Ask Ask
01013657740 FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 Info SFC SFC-27845 1 EA Ask Ask
01013702240 Recombinant Human Galectin-Related Protein/LGALSL (C-6His) Info novo CE89-1000 1 mg Ask Ask
01013702359 Recombinant Human Galectin-Related Protein/LGALSL (C-6His) Info novo CE89-10 10 ug Ask Ask
01013706334 Recombinant Human Galectin-Related Protein/LGALSL (C-6His) Info novo CE89-50 50 ug Ask Ask
01013706419 Recombinant Human Galectin-Related Protein/LGALSL (C-6His) Info novo CE89-500 500 ug Ask Ask
01014413115 Rabbit LGALSL Polyclonal Antibody Info ABclonal A14880 50ul Ask Ask
01014499683 LGALSL Adenovirus (Human) Info abm Adinovirus 344744A 250ul Ask Ask
01014499684 LGALSL-HA Adenovirus (Human) Info abm Adinovirus 344745A 250ul Ask Ask
01014499685 LGALSL-His Adenovirus (Human) Info abm Adinovirus 344746A 250ul Ask Ask
01014751270 PLSL Polyclonal Antibody Info EnoGene E11-200002 100ug/100ul Ask Ask
01015737627 CrystalSlide Info Jenabiosciences CD-501L 20pcs. Ask Ask
01015737629 CrystalSlide Info Jenabiosciences CD-501S 2X4pcs. Ask Ask
01015898643 CrystalSlide,12 channels, 20/cs Info MiTeGen M-444820 1 cs Ask Ask
01015902780 Etiketten voor TLS2200 / PTLSL-17-473 Info Brady Benelux NL PTLSL-17-473 2X500Label(s) Ask Ask
01015954815 Recombinant Pongo abelii Galectin-related protein (LGALSL) Info MyBioSource MBS1306090 0,05 mg (E-Coli) Ask Ask
01015958134 Recombinant Mouse Galectin-related protein B (Lgalslb) Info MyBioSource MBS1309409 0,05 mg (E-Coli) Ask Ask
01015959800 Recombinant Mouse Galectin-related protein A (Lgalsla) Info MyBioSource MBS1311075 0,05 mg (E-Coli) Ask Ask
01015960916 Recombinant Lactobacillus salivarius Putative Holliday junction resolvase (LSL_1109) Info MyBioSource MBS1312191 0,05 mg (E-Coli) Ask Ask
01015968535 Recombinant Lactobacillus salivarius Probable transcriptional regulatory protein LSL_0422 (LSL_0422) Info MyBioSource MBS1319811 0,05 mg (E-Coli) Ask Ask
01015971539 Recombinant Lactobacillus salivarius UPF0342 protein LSL_0473 (LSL_0473) Info MyBioSource MBS1322815 0,05 mg (E-Coli) Ask Ask
01015973839 Recombinant Lactobacillus salivarius UPF0398 protein LSL_0930 (LSL_0930) Info MyBioSource MBS1325115 0,05 mg (E-Coli) Ask Ask
01015980677 Recombinant Lactobacillus salivarius UPF0042 nucleotide-binding protein LSL_1171 (LSL_1171) Info MyBioSource MBS1331953 0,05 mg (E-Coli) Ask Ask
01015982929 Recombinant Lactobacillus salivarius N-acetyldiaminopimelate deacetylase (LSL_0469) Info MyBioSource MBS1334205 0,05 mg (E-Coli) Ask Ask
01015996349 Recombinant Danio rerio Galectin-related protein (lgalsl) Info MyBioSource MBS1347626 0,05 mg (E-Coli) Ask Ask
01016003355 Recombinant Lactobacillus salivarius UPF0122 protein LSL_0628 (LSL_0628) Info MyBioSource MBS1354634 0,05 mg (E-Coli) Ask Ask
01016019903 Recombinant Human Galectin-related protein (LGALSL) Info MyBioSource MBS1371185 0,05 mg (E-Coli) Ask Ask
01016035773 Recombinant Lactobacillus salivarius UPF0173 metal-dependent hydrolase LSL_0324 (LSL_0324) Info MyBioSource MBS1387056 0,05 mg (E-Coli) Ask Ask
01016045043 Recombinant Chicken Galectin-related protein (LGALSL) Info MyBioSource MBS1396327 0,05 mg (E-Coli) Ask Ask
01016046602 Recombinant Lactobacillus salivarius Ferredoxin--NADP reductase (LSL_0439) Info MyBioSource MBS1397886 0,05 mg (E-Coli) Ask Ask
01016051666 Recombinant Lactobacillus salivarius UPF0145 protein LSL_1614 (LSL_1614) Info MyBioSource MBS1402950 0,05 mg (E-Coli) Ask Ask
01016067950 Recombinant Lactobacillus salivarius Putative phosphotransferase LSL_0699 (LSL_0699) Info MyBioSource MBS1419238 0,05 mg (E-Coli) Ask Ask
01016091500 Recombinant Lactobacillus salivarius UPF0348 protein LSL_0505 (LSL_0505) Info MyBioSource MBS1442788 0,05 mg (E-Coli) Ask Ask
01016105343 Recombinant Lactobacillus salivarius UPF0473 protein LSL_1108 (LSL_1108) Info MyBioSource MBS1456631 0,05 mg (E-Coli) Ask Ask
01016114329 Recombinant Lactobacillus salivarius UPF0133 protein LSL_1227 (LSL_1227) Info MyBioSource MBS1465620 0,05 mg (E-Coli) Ask Ask
01016115711 Recombinant Lactobacillus salivarius Initiation-control protein yabA (LSL_1222) Info MyBioSource MBS1467003 0,05 mg (E-Coli) Ask Ask
Ajax processing
LSL - Search
Filters
Sitemap Contact
$
  • EUR
  • GBP
  • PLN
  • USD
X
Total products: 414 Current page: 1  Go to first | Next
Contact us
Ajax processing
Close
Chat with gentaur.com employee