Disulfide - Search

01010054318 Human Protein disulfide-isomerase A3 (PDIA3) ELISA Kit ab-elisa elisas AE28187HU 96 wells plate Ask

01010066707 Molybdenum Disulfide purified Research sys 37233 500 Gms Ask

01010096066 Disulfide-bond isomerase (DsbC) genways bulk GWB-2BD1DA bulk Ask

01010122871 Anti- Protein Disulfide Isomerase A2 (PDIA2) Antibody MBS Polyclonals GEN2014452 50ug Ask

01010124982 Anti- Protein Disulfide Isomerase (PDI) Antibody MBS Polyclonals GEN2016378 100ug Ask

01010165783 Anti- Protein Disulfide Isomerase A2 (PDIA2) Antibody MBS Polyclonals GEN2013892 100ug Ask

01010256318 Anti- WAP Four Disulfide Core Domain Protein 5 (WFDC5) Antibody MBS Polyclonals GEN2014912 100ug Ask

01010350144 Anti- Protein Disulfide Isomerase A3 (PDIA3) Antibody MBS Polyclonals GEN2006376 50ug Ask

01010406262 Anti- Protein Disulfide Isomerase A2 (PDIA2) Antibody MBS Polyclonals GEN2016430 100ug Ask

01010419329 Anti- Protein Disulfide Isomerase (PDI) Antibody MBS Polyclonals GEN2018191 100ug Ask

01010438017 Tungsten Disulfide Nanopowder Research sys 78519 25 Gms Ask

01010542101 Molybdenum Disulfide Nanopowder Lubricant Grade Research sys 83005 5 Gms Ask

01010564007 Disulfide oxidoreductase (DsbA) genways bulk GWB-2DDE00 bulk Ask

01010597358 Anti- WAP Four Disulfide Core Domain Protein 5 (WFDC5) Antibody MBS Polyclonals GEN2004690 100ug Ask

01010680380 Anti- Protein Disulfide Isomerase (PDI) Antibody MBS Polyclonals GEN2003737 50ug Ask

01010682538 Tungsten Disulfide extrapurified Research sys 53032 100 Gms Ask

01010706601 Anti- WAP Four Disulfide Core Domain Protein 5 (WFDC5) Antibody MBS Polyclonals GEN2005548 100ug Ask

01010709220 Protein Disulfide Isomerase (PDI), ~58kD doublet, Clone: 1D3, Mouse Monoclonal antibody-Rat, Bovine, Human, Monkey, Mouse, Hamster, Chicken, Dog, Guinea pig, Swine, Xenopus; WB/IP/ICC/IHC accurate-monoclonals YSGSPA891 0.2mg Ask

01010841647 Anti- Protein Disulfide Isomerase (PDI) Antibody MBS Polyclonals GEN2006411 100ug Ask

01010843094 Anti- Protein Disulfide Isomerase A3 (PDIA3) Antibody MBS Polyclonals GEN2013679 100ug Ask

01010967430 Recombinant Human Protein Disulfide Isomerase A3 genways bulk GWB-20912A bulk Ask

01010983065 Recombinant E.Coli Thiol Disulfide Interchange Protein genways bulk GWB-3C0E55 bulk Ask

01011054112 Anti- Protein Disulfide Isomerase (PDI) Antibody MBS Polyclonals GEN2003685 50ug Ask

01011099370 Anti- Protein Disulfide Isomerase A3 (PDIA3) Antibody MBS Polyclonals GEN2008877 100ug Ask

01011152581 Tungsten Disulfide (WS2) Aerosol Spray (13Oz/369g) Research sys 23882 1 piece Ask

01011163815 Recombinant E.Coli Thiol Disulfide Interchange Protein genways bulk GWB-1E9B7F bulk Ask

01011196116 Protein Disulfide Isomerase (PDI), ~58kD doublet, Clone: 1D3, Mouse Monoclonal antibody-Rat, Bovine, Human, Monkey, Mouse, Hamster, Chicken, Dog, Guinea pig, Swine, Xenopus; WB/IP/ICC/IHC accurate-monoclonals YSGSPA891D 50 ug Ask

01011286370 Anti- Protein Disulfide Isomerase (PDI) Antibody MBS Polyclonals GEN2002497 100ug Ask

01011389494 Human Protein disulfide-isomerase A3 (PDIA3) ELISA Kit abebio AE28187HU-96 1x plate of 96 wells Ask

01011390007 Mouse WAP four-disulfide core domain protein 8 (WFDC8) ELISA Kit abebio AE11214MO-96 1x plate of 96 wells Ask

01011390008 Mouse WAP four-disulfide core domain protein 2 (WFDC2) ELISA Kit abebio AE11223MO-96 1x plate of 96 wells Ask

01011390009 Mouse WAP four-disulfide core domain protein 12 (WFDC12) ELISA Kit abebio AE11227MO-96 1x plate of 96 wells Ask

01011390010 Mouse WAP four-disulfide core domain protein 1 (WFDC1) ELISA Kit abebio AE11233MO-96 1x plate of 96 wells Ask

01011394921 ELISA test for Human Protein disulfide-isomerase A3 (PDIA3) abebio AE28187HU-48 1x plate of 48 wells Ask

01011395434 ELISA test for Mouse WAP four-disulfide core domain protein 8 (WFDC8) abebio AE11214MO-48 1x plate of 48 wells Ask

01011395435 ELISA test for Mouse WAP four-disulfide core domain protein 2 (WFDC2) abebio AE11223MO-48 1x plate of 48 wells Ask

01011395436 ELISA test for Mouse WAP four-disulfide core domain protein 12 (WFDC12) abebio AE11227MO-48 1x plate of 48 wells Ask

01011395437 ELISA test for Mouse WAP four-disulfide core domain protein 1 (WFDC1) abebio AE11233MO-48 1x plate of 48 wells Ask

01011865244 protein disulfide-isomerase A3(PDIA3) ELISA Kit sincere E13651505 one plate of 96 wells per kit Ask

01011865245 Protein disulfide-isomerase precursor(PDI) ELISA Kit sincere E13651506 one plate of 96 wells per kit Ask

01011903205 anti-DsbA-L (Disulfide-bond-A oxidoreductase-like protein) Antibody proscience 50-102 0.1 mL Ask

01011984060 β-Defensin-3, human (GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: Cys11-Cys40, Cys18-Cys33, Cys23-Cys41) (MW: 5155.22) adi SP-100511-1 1 mg Ask

01011984061 Defensin-1 (human) HNP-1 (AA: Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridges Cys2-Cys30, Cys4-Cys19, and Cys 9-29 )) (MW: 3442.1) adi SP-100512-1 1 mg Ask

01011984066 Aldosterone Secretion Inhibiting Factor (1-35) (bovine) (AA: Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge:Cys13-Cys29) (MW: 3910.64) adi SP-100519-1 1 mg Ask

01011984071 [Cys18]-Atrial Natriuretic Factor (4-18) amide (rat)[Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Cys-NH2; (Disulfide bridge:Cys7-Cys18); MW: 1594.9] adi SP-100524-5 5 mg Ask

01011984074 Big Endothelin -1 (1-39), porcine (AA: Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Ile-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Ser-Arg-Ser (Disulfide bridge: Cys1-Cys15, Cys3-Cys11)) adi SP-100527-1 1 mg Ask

01011984075 [Tyr0]-Atriopeptin II (rat) [Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg (Disulfide bridge:Cys4-Cys20 ); MW 2549.9] adi SP-100529-1 1 mg Ask

01011984076 mini-ANP (AA:Met-Cys-His-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Ser-Cys-Tyr-Arg-NH2 (Disulfide bridge:Cys2-Cys13)) (MW: 1829.19) adi SP-100530-1 1 mg Ask

01011984130 Allatotropin, Mas – AT (AA:Gly-Phe-Lys-Asn-Val-Glu-Met-Met-Thr-Ala-Arg-Gly-Phe-NH2 (Disulfide bridge:Cys2-Cys7) (MW: 1486.8) adi SP-100835-1 1 mg Ask

01011984153 Biotin-Atrial Natriuretic Peptide (1-28), human, porcine (AA: Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23)) (MW: 3308.8) adi SP-101108-1 1 mg Ask