AIRA - Search

01011287245 Human AIRA ELISA kit Kamiya KT-6879 96 well plate Ask

01012666695 Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA) trca P285260 1 mg Ask

01016078354 Recombinant Makaira nigricans Myoglobin (mb) MyBioSource MBS1429642 0,05 mg (E-Coli) Ask

01016976730 Foot-and-Mouth Disease Virus (FMDV) Serotype Airan Real Time RT-PCR Kit Liferiver ZR-0137-09 25tests/kit Ask

01016976731 Foot-and-Mouth Disease Virus (FMDV) Serotype Airan Real Time RT-PCR Kit Liferiver ZR-0137-10 25tests/kit Ask

01018396176 AIRA ELISA KIT|Human Lifescience Market EF006583 96 Tests Ask

01018487939 Recombinant Human Growth and Differentiation factor 15 D-Vairant CHI Scientific 7-00481 2µg Ask

01018487940 Recombinant Human Growth and Differentiation factor 15 D-Vairant CHI Scientific 7-00482 10µg Ask

01018487941 Recombinant Human Growth and Differentiation factor 15 D-Vairant CHI Scientific 7-00483 1mg Ask

01018742607 Human AIRA ELISA Kit Abbexa abx150602 96 tests Ask

01018770647 Growth and Differentiation factor 15 D-Vairant Protein (Recombinant) Abbexa abx262098 5 µg Ask

01022881319 Makaira nigricans Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (atp2a1)-E. coli MBS Recombinant GEN1060004.E.coli 1000ug Ask

01022881320 Makaira nigricans Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (atp2a1)-Yeast MBS Recombinant GEN1060004.Yeast 1000ug Ask

01023128559 Proechimys guairae Ribonuclease pancreatic (RNASE1) -E. coli MBS Recombinant GEN1136425.E.coli 1000ug Ask

01023128560 Proechimys guairae Ribonuclease pancreatic (RNASE1) -Baculovirus MBS Recombinant GEN1136425.Baculovirus 100ug Ask

01023128561 Proechimys guairae Ribonuclease pancreatic (RNASE1) -Yeast MBS Recombinant GEN1136425.Yeast 1000ug Ask

01023128562 Proechimys guairae Ribonuclease pancreatic (RNASE1) -Mammalian Cell MBS Recombinant GEN1136425.Mammalian Cell 100ug Ask

01023197601 Proechimys guairae Myoglobin (MB) -E. coli MBS Recombinant GEN1157829.E.coli 1000ug Ask

01023197602 Proechimys guairae Myoglobin (MB) -Baculovirus MBS Recombinant GEN1157829.Baculovirus 100ug Ask

01023197603 Proechimys guairae Myoglobin (MB) -Yeast MBS Recombinant GEN1157829.Yeast 1000ug Ask

01023197604 Proechimys guairae Myoglobin (MB) -Mammalian Cell MBS Recombinant GEN1157829.Mammalian Cell 100ug Ask

01025020084 Recombinant Makaira nigricans Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (atp2a1) MyBioSource MBS1060004 1 mg (E-Coli) Ask

01025271165 Recombinant Human Growth and Differentiation factor 15 D-Vairant MyBioSource MBS144153 0.005 mg Ask

01035020084 Recombinant Makaira nigricans Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (atp2a1), partial MyBioSource MBS1060004 1 mg (E-Coli) Ask

02016898615 Human anti-insln receptor antibody,AIRA ELISA Kit Glorybioscience GBS-10416 1 kit (96 wells plate) Ask

02016900860 Human anti-insln receptor antibody (AIRA) ELISA Kit Glorybioscience GBS-90091 1 kit (96 wells plate) Ask

02016906813 AIRA (Anti-insln Receptor Antibody), Chicken, ELISA Kit Glorybioscience GBS-B3535 1 kit (96 wells plate) Ask

02016906814 AIRA (Anti-insln Receptor Antibody), Human, ELISA Kit Glorybioscience GBS-B3536 1 kit (96 wells plate) Ask

02016906815 AIRA (Anti-insln Receptor Antibody), Monkey, ELISA Kit Glorybioscience GBS-B3537 1 kit (96 wells plate) Ask

02016906816 AIRA (Anti-insln Receptor Antibody), Pig, ELISA Kit Glorybioscience GBS-B3538 1 kit (96 wells plate) Ask

02016906817 AIRA (Anti-insln Receptor Antibody), Rabbit, ELISA Kit Glorybioscience GBS-B3539 1 kit (96 wells plate) Ask

02016908836 Anti-insln Receptor Antibody (AIRA), Human, ELISA Kit Glorybioscience GBS-B5596 1 kit (96 wells plate) Ask

02016908837 Anti-insln receptor antibody, AIRA, Human, ELISA Kit Glorybioscience GBS-B5597 1 kit (96 wells plate) Ask

02018770647 Growth and Differentiation factor 15 D-Vairant Protein (Recombinant) Abbexa abx262098 20 µg Ask

02021287245 Human AIRA ELISA Kit Kamiya KT-6879 96 tests Ask

02025271165 Recombinant Human Growth and Differentiation factor 15 D-Vairant MyBioSource MBS144153 0.02 mg Ask

02035020084 Recombinant Makaira nigricans Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (atp2a1), partial MyBioSource MBS1060004 1 mg (Yeast) Ask

03015020084 Recombinant Makaira nigricans Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (atp2a1)[Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (atp2a1)] MyBioSource MBS1060004 NA Ask

03015099915 Recombinant Proechimys guairae Ribonuclease pancreatic (RNASE1)[Ribonuclease pancreatic (RNASE1)] MyBioSource MBS1136425 0.2 mg (E-Coli) Ask

03015121313 Recombinant Proechimys guairae Myoglobin (MB)[Myoglobin (MB)] MyBioSource MBS1157829 0.2 mg (E-Coli) Ask

03015271165 Recombinant Human Growth and Differentiation factor 15 D-Vairant[Growth and Differentiation factor 15 D-Vairant] MyBioSource MBS144153 1 mg Ask

03018770647 Growth and Differentiation factor 15 D-Vairant Protein (Recombinant) Abbexa abx262098 1 mg Ask

03025271165 Recombinant Human Growth and Differentiation factor 15 D-Vairant MyBioSource MBS144153 1 mg Ask

04025099915 Recombinant Proechimys guairae Ribonuclease pancreatic (RNASE1) MyBioSource MBS1136425 0,05 mg (E-Coli) Ask

04025121313 Recombinant Proechimys guairae Myoglobin (MB) MyBioSource MBS1157829 0,05 mg (E-Coli) Ask

04025271165 Recombinant Human Growth and Differentiation factor 15 D-Vairant MyBioSource MBS144153 0,005 mg Ask

05025099915 Recombinant Proechimys guairae Ribonuclease pancreatic (RNASE1) MyBioSource MBS1136425 0.02 mg (Yeast) Ask

05025121313 Recombinant Proechimys guairae Myoglobin (MB) MyBioSource MBS1157829 0.02 mg (Yeast) Ask

05025271165 Recombinant Human Growth and Differentiation factor 15 D-Vairant MyBioSource MBS144153 5x0.02 mg Ask

06025099915 Recombinant Proechimys guairae Ribonuclease pancreatic (RNASE1) MyBioSource MBS1136425 0.1 mg (Yeast) Ask