Filters
Technique
Supplier
Species
Label
Isotype
Host
E Coli or Yeast or Baculovirus or Mammalian Cell (3776675)
Rabbit (262822)
mouse (90291)
Rabbit Oryctolagus cuniculus (53941)
Goat (47278)
Mouse (43136)
E Coli (39801)
Rat (37678)
coli (16903)
Source Human Homo sapiens (8815)
Host Rabbit Oryctolagus cuniculus (7923)
Sheep (6807)
Yeast (6142)
N A (5463)
Assay (4642)
e. coli (2717)
Synthetic (2382)
mouse monoclonal (2112)
Hamster (1823)
Sf9 (1749)
Mouse Mus musculus (1576)
Donkey (1382)
Baculovirus cells (1357)
Human (1339)
Chicken (1177)
HEK293 cells (1146)
Horse (1078)
Synthetic peptide (1063)
Host Mouse Mus musculus (1015)
Sf9 insect cells (992)
Host Goat (784)
Host Sheep (587)
Escherichia Coli (542)
Source Sheep serum (540)
HEK 293 cells (537)
Mouse Source Human (504)
Recombinant (504)
Source Rabbit serum (503)
Source Mouse Mus musculus (502)
Host Rabbit (499)
Baculovirus (460)
Baculovirus Insect cells (436)
chemical synthesis (426)
Mammalian cells (423)
Sf9 Insect Cells (418)
Rat Rattus norvegicus (410)
Sf9 Baculovirus Cells (398)
Camel (329)
Host Rabbit Source Human (328)
Insect cells (294)
recombinant (292)
HEk293 Cells (280)
MouseSource Human (278)
Insect Cells (275)
Pichia pastoris (255)
Armenian Hamster (250)
Guinea Pig (236)
HEK293 Cells (236)
Source Zebrafish (231)
CHO cells (206)
Host Mouse (206)
cho (191)
E ColiSource Human (189)
Baculovirus Cells (187)
Swine (185)
Host Rabbit Source Rat (178)
Host RabbitSource Human (167)
HEK (163)
CHO Cells (156)
HEK 293 cellsSource Human (138)
Mouse Balb c (122)
Source Hybridoma cell culture (121)
Human 293 cell expressed (119)
Host Rabbit Source Mouse (117)
HEK 293 (116)
Pichia Pastoris (114)
Baculovirus Insect Cells (110)
Guinea pig (109)
Source Rat Rattus norvegicus (103)
Host Mouse Source Ascites Fluid (102)
Coli (100)
HEK 293 cells Source Human (100)
Chinese Hamster Ovarian Cells CHO (94)
Host RabbitSource Rat (89)
Sf9 Insect cells (89)
Baculovirus infected Sf9 cells (86)
Syrian Hamster (85)
HEK293 (80)
Rabbit Source Human (74)
Human E Coli (73)
Source Mouse ascites (64)
NA (63)
Host RabbitSource Mouse (62)
Prokaryotic expression (58)
Host MouseSource Ascites Fluid (56)
Sf9 cells (55)
Mammalian Cell (46)
RabbitSource Human (46)
Escherichia coli (45)
Recombinant E Coli (45)
Saccharomyces cerevisiae (45)
HEK 293 cellsSource Mouse (44)
Host Rat (44)
HEK Cells (43)
Human from E Coli (42)
HEK293 cellsSource Human (40)
Source Rat ascites (37)
Recombinant Human (36)
CHO (35)
Insect cell culture (35)
Chicken Eggs (30)
Chinese Hamster Ovary Cells CHO (30)
Host Mouse Source Human (30)
E ColiSource Mouse (29)
Mouse hybridoma (28)
Nicotiana benthamiana (28)
Sf9 Baculovirus (28)
human E Coli (28)
Nicotiana benthamiana plant (27)
Recombinant Mouse (27)
Source Porcine (26)
Cell Free Expression (25)
E Coli Source Human (25)
Baculovirus expression system (24)
Mammalian Cells (24)
Source Goat serum (24)
Cultured in vitro (22)
Drosophia (22)
HEK293 Human Embryonic Kidney cell line (21)
Llama (21)
Mouse Ascites (21)
SF9 insect cells (21)
cerevisiae (21)
Insect Cell Expression System (20)
Source Ascites (20)
E coli (19)
Host MouseSource Human (19)
Recombinant human (19)
Saccharomyces Cerevisiae (19)
expressed in E Coli (19)
recombinant E Coli (19)
Hi 5 cells (18)
Human plasma (18)
Sf21 cells (17)
BaculovirusSource Human (16)
Hamster Armenian (16)
Host Goat Source Human (16)
Recombinant Human E Coli (16)
Saccharomyces cerevisae (16)
293 Cell Line Human Embryonic Kidney (15)
Baculovirus in Sf9 insect cells (15)
HEK293 Human embryonic kidney cell line (15)
Human cell expressed (15)
Mouse ascites (15)
Rb (15)
Recombinant from E Coli (15)
Rice Grain Oryza Sativa (15)
BaculovirusSource Mouse (14)
HEK cells (14)
Host Chicken Source Rat (14)
Human 293 cells (14)
Chinese hamster ovary CHO cells (13)
Drosophila S2 (13)
Human recombinant protein expressed in E Coli (13)
Insect Cell (13)
Insect cell (13)
SF21 Insect cells (13)
BTI Tn 5B1 4 Hi 5 Insect Cells (12)
Baculovirus Sf9 insect cells (12)
Cloned from HBV 320 genome (12)
HEK293E Cells (12)
Host Chicken Source Human (12)
Human cells (12)
Human recombinant from E Coli (12)
Mammalian Cell Line (12)
Pichia (12)
Protein conjugation (12)
Purified From HEK 293 Cell culture Supernatant (12)
Recombinant Human E coli (12)
Sf9 CELLS INSECT (12)
Source Bovine (12)
Yeast or Baculovirus or Mammalian Cell (12)
Goat Serum (11)
HEK 293 cellsSource Rabbit (11)
HEK 293 cellsSource Rat (11)
Pastoris (11)
Baculovirus Sf9 Cells (10)
Baculovirus infected Silkworm (10)
Hi 5 Cells (10)
Insect cell Baculovirus Source Mouse (10)
Mouse chimeric (10)
Mouse myeloma cell line (10)
Rice Grain (10)
Sheep serum (10)
Tritirachium album (10)
insect cells (10)
CHO cellsSource Human (9)
E ColiSource Yeast (9)
Hansenula polymorpha (9)
Hi 5 cell (9)
Host E (9)
Host GoatSource Human (9)
IgG and IgA paraproteins (9)
Leishmania tarentolae (9)
Mammalian cell (9)
MouseSource Ascites (9)
Murine (9)
Murine E Coli (9)
NS0 (9)
NSO cells (9)
New Zealand Rabbit (9)
Recombinant E Coli strain (9)
Sf21 insect cells (9)
and human IgM (9)
coliSource E Coli (9)
recombinant from yeast cells (9)
Baculovirus system (8)
CHO cellsSource Mouse (8)
Chinese Hamster Ovarian Cells (8)
E ColiStrain AD169 (8)
HEK 293 cellsSource Bundibugyo virus (8)
Host Chicken Source Opossum (8)
Host Mouse Source Rat (8)
Host Rabbit Source Porcine (8)
Human cDNA (8)
Human serum (8)
Ms (8)
Purified from S (8)
Sacharomyces cerevisiae (8)
Source Canine (8)
coli recombinant (8)
expressed in E (8)
yeast recombinant (8)
Baculovirus infected High 5 cells (7)
Expressed in E Coli (7)
Host ChickenSource Human (7)
Host ChickenSource Rat (7)
Host Guinea pig (7)
Human Cells (7)
Human Plasma (7)
Insect Sf9 Cells (7)
Mouse Source Ascites (7)
Rat recombinant protein expressed in E Coli (7)
Recombinant murine (7)
Source Culture (7)
Source Guinea pig (7)
Source Rabbit Oryctolagus cuniculus (7)
cultured in vitro (7)
humanized antibody cultured in vitro (7)
BTI Tn 5B1 4 Hi 5 Insect cells (6)
Chinese Hamster Ovary Cells (6)
Chinese Hamster Ovary cells (6)
Goat Country of Origin USA (6)
Goat serum (6)
HEK293T cells (6)
Host Goat Source Rat (6)
Host Rabbit Source E Coli (6)
Host Rabbit Source Opossum (6)
Host Sheeep (6)
Human 293 Cells (6)
Human CD33 Signal Peptide (6)
Human Mouse chimeric (6)
Insect Cell Line (6)
Mammalian Cell Expression System HEK293 (6)
Mouse BALB c (6)
Mouse Source Mouse (6)
Recombinant protein from E Coli (6)
Source Chicken (6)
Source Equine (6)
Strain producer of yeast Saccharomyces cerevisiae (6)
adw subtype (6)
containing plasmid pCGA7 (6)
293 cells (5)
Aeromonas Proteolytica (5)
Aeromonas proteolytica (5)
Armenian hamster (5)
BHK cells Baby Hamster Kidney Cells (5)
Baculovirus sf9 cells (5)
Baculovirus sytem (5)
Corn (5)
Drosophila Schneider 2 S2 cells (5)
Escherichia Cali (5)
Expressed in mammalian cell line (5)
HEK 293 cell line Human embryonic kidney (5)
HEK HumaXpress (5)
HEK Human embryonic kidney cells (5)
Hi 5 (5)
Hi 5 Baculovirus (5)
Hi 5 Insect Cells (5)
High Five insect cells (5)
Host MouseSource Cell Culture (5)
Human Embryonic Kidney 293 Cells (5)
Human Embryonic Kidney 293 cells (5)
Human Embryonic Kidney HEK cells (5)
Hybridoma cell culture (5)
Insects expression (5)
Mammalian cell expression system (5)
Mammalian system (5)
Mammals (5)
Pichia Pastoria (5)
Rice Flour (5)
Spodoptera frugiperda (5)
Yeast cells (5)
coli Full Length protein P04406 (5)
coli Full length protein O15392 (5)
coli Full length protein P07306 (5)
coli Ser32 Lys333 P15529 (5)
coli Ser381 Gly683 P02788 (5)
human (5)
A293 cells (4)
Ag8 (4)
American Hamster (4)
BHK cells (4)
BTI Tn 5B1 4 High 5 Insect cells (4)
BTI Tn 5B1 4 High 5 insect cells (4)
Bacillus subtilis (4)
Bee venom (4)
Bovine E Coli (4)
CHO K1 (4)
Cell culture (4)
Chimeric (4)
Corn Zea Mays (4)
E Coli Accession Number NP_005558 (4)
E ColiSource Acidaminococcus fermentans (4)
E ColiSource Bacillus subtilis (4)
E ColiSource Geobacillus stearothermophilus (4)
E ColiSource HIV1 (4)
E ColiSource HIV2 (4)
E ColiSource HRV14 (4)
E ColiSource Japanese encephalitis Virus (4)
E ColiSource Norovirus GI (4)
E ColiSource West Nile virus (4)
E ColiSource Zika virus strain Mr 766 ZIKV (4)
Escherichia Colilambda lysogen NM 989 (4)
Expressed in an insect cell line (4)
Genetically engineered E Coli (4)
HEK 293 cells Met1 Glu 215 (4)
HEK 293 cells Source Influenza A virus (4)
HEK 293 cells Source Mouse (4)
HEK 293 cellsSource Cynomolgus (4)
HEK 293 cellsSource Rhesus macaque (4)
HEK 293 cellsSource Zaire ebolavirus (4)
HEK293 cells Cys 32 His 430 (4)
HEK293 cells Gin 45 Ser 833 (4)
HEK293 cells Thr 25 Met 231 (4)
HEK293 cells Val 26 Gln 205 (4)
Hamster E Coli (4)
Hansenula Polymorpha (4)
HeLa cells (4)
Hi 5 insect cells (4)
Hi5 cells (4)
High 5 cells (4)
Host ChickenSource Opossum (4)
Host Horse (4)
Host Mouse Source Mouse ascites (4)
Host MouseSource Rat (4)
Host Rabbit Source Drosophila (4)
Host RabbitSource Porcine (4)
Human CHO cells (4)
Human embryonic kidney cell line (4)
Human humanized antibody (4)
Human mouse heterohybridoma (4)
Hybridization of P3X63 (4)
Insect cellSource Mouse (4)
Mammalian Cell Expression System (4)
Mammalian cell line (4)
Mouse Source Artificial tag (4)
MouseSource E Coli (4)
NS0 cells (4)
Pichia pasroris (4)
Purified from E Coli recombinant (4)
Purified from whole goat anti sera (4)
Rabbit Source Schistosoma japonicum (4)
Rabbitt (4)
Rat E Coli (4)
Rat brain mRNA (4)
Recombinant Human IL 8 E Coli (4)
Recombinant Human MCP E Coli (4)
Recombinant truncated HEV ORF2 (4)
SARS CoV 2 coronavirus (4)
Sf9 insect cells Baculovirus (4)
Source Horse serum (4)
Source Monkey (4)
Soy Bean (4)
Two mouse hybridomas (4)
coli 11 179 AA Q03135 (4)
coli AA 1 165 P0DN86 (4)
coli AA 1 166 P23528 (4)
coli AA 1 188 O95445 (4)
coli AA 1 188 P01116 (4)
coli AA 101 469 P03956 (4)
coli AA 121 220 P51654 (4)
coli AA 1288 1632 P26358 (4)
coli AA 21 124 Q14508 (4)
coli AA 21 132 P01222 (4)
coli AA 210 346 P14780 (4)
coli AA 28 127 P04114 (4)
coli AA 80 400 P08727 (4)
coli AA 807 1050 P00450 (4)
expressed in Hansenula polymorpha (4)
genotype 3 (4)
rabbit (4)
recombinant from E Coli (4)
288 302 peptide (3)
Bacteria (3)
Baculovirus in Sf9 cells (3)
Baculovirus infected Bombyx Mori (3)
Baculovirus infected Sf9 (3)
Baculovirus insect cells (3)
CHO Cell (3)
CHO Recombinant Mouse (3)
Canine (3)
Cell CultureSource CHO Cells (3)
Chimera (3)
Chinese Hamster Ovary CHO cells (3)
Clostridium difficile (3)
Drosophilla (3)
E Coli derived (3)
E Coli derived recombinant (3)
E Coli full length aa1 313 (3)
E Coli lysate (3)
E ColiSource Rat (3)
E ColiSource Trichomonas vaginalis (3)
E ColiStrain C194 (3)
E ColiStrain Ellen (3)
E ColiStrain IIIB (3)
EGF1 52 (3)
Freestyle 293 F cell (3)
HEK 293 cells Asp 23 Arg 227 (3)
HEK 293 cells lle 20 Glu 512 (3)
HEK293 cells Asp 27 Leu 342 (3)
Hi 5 Insect cells (3)
Hi 5 Insect cells BTI Tn 5B1 4 (3)
His tagged (3)
Horse American source (3)
Host GoatSource Rat (3)
Host Mouse ascites (3)
Host MouseSource Ascites (3)
Host MouseSource Cell Culture Supernatant (3)
Host RabbitSource Drosophila (3)
Host RabbitSource E Coli (3)
Host RabbitSource Opossum (3)
Host Source CHO cells (3)
Human CD33 signal peptide (3)
Human GST my GST M1 1 (3)
Human recombinant (3)
Human recombinant kidney (3)
Human synthetic peptide (3)
IgG1 Kappa (3)
IgG3 Kappa (3)
Insect SF21 cells baculovirus expression system (3)
Insect cell expression system (3)
Insect cells Baculovirus (3)
Met1 Gln333 (3)
MouseSource Mouse (3)
Murine E coli (3)
Murine myeloma cell line (3)
Mycobacterium bovis BCG (3)
NP_001665 (3)
NS0 derived (3)
NS0 derived human CD45 (3)
NSO (3)
NSO Recombinant (3)
OPN Knockout Mouse (3)
Oryza sativa rice (3)
Partially purified IgG fraction of rabbit serum (3)
Pepsin digest of goat anti human IgA (3)
Pepsin digest of goat anti mouse Ig (3)
Pepsin digest of goat anti mouse IgM (3)
Pepsin digest of goat anti rat IgG (3)
Pepsin digest of rabbit anti mouse IgG H L (3)
Purified from E Coli (3)
Purified from a recombinant source (3)
QNRLLIRAREDFGVE (3)
Recombinant Canine (3)
Recombinant Rat (3)
Recombinant bovine IL 4 (3)
Recombinant corresponding to aa1 181 of human ATF3 (3)
Recombinant expressed in E Coli (3)
Recombinant human LAG 3 produced in CHO cells (3)
Recombinant human STK10 (3)
Recombinant mouse (3)
Recombinant protein E Coli (3)
Recombination (3)
Rice (3)
SF 9 Baculovirus (3)
Saccharomyces cereviae containing plasmid pCGA7 (3)
Sf21cells (3)
Sf9 cell (3)
Source E (3)
Source E Coli (3)
Source Hamster (3)
Strain IIIB (3)
Synthetic human NPR B a (3)
Synthetic peptide human (3)
aa1 (3)
ayw subtype (3)
bacteria (3)
cerevisae (3)
full length aa1 344 (3)
human Sf21 cell (3)
mouse from E Coli (3)
purified (3)
rat (3)
rat from E Coli (3)
recombinant protein (3)
sequence 14AQMSEDNHLSNTVRSQNDNR33 (3)
1 VLP (2)
1aa 187 (2)
Bovine recombinant protein expressed in E Coli (2)
Chilobrachys jingzhao (2)
Chinese earth tiger tarantula (2)
Coli recombinant (2)
Cultured in vivo (2)
Drosophila (2)
E Coli BL21 (2)
E ColiStrain Dumas (2)
Eukaryotic expression 293 F cell (2)
HEK 293 cells Glu 19 Asn 250 (2)
HEK 293 cells Glu 25 Lys 418 (2)
Host Chicken Source Mouse (2)
Host Goat Source Human apolipoprotein AII (2)
Host Goat Source Mouse (2)
Host Goat Source Rabbit (2)
Host Mouse Source Ascites (2)
Host Mouse Source Bovine (2)
Host Mouse Source Porcine (2)
Host MouseSource Bovine (2)
Host Rabbit Source Bovine (2)
Host Rabbit Source Chicken (2)
Host Rat Source Mouse (2)
Host Sheep Source Mouse (2)
Human 293 Cells HEK293 (2)
Human cell culture (2)
Insect cell lysate (2)
Mammalian Cell expression System HEK293 (2)
Mammalian HEK293 Cells (2)
Mouse BALB c IgG1k (2)
Mouse NSO 1 cells (2)
Mouse Source Bacillus anthracis (2)
Mouse Source E Coli (2)
Mouse Source Rabbit (2)
MouseSource Artificial tag (2)
Others (2)
Papain digest of goat anti human IgG (2)
Photinus pyralis (2)
Produced in E Coli (2)
Rabbit Source E Coli (2)
RabbitSource Schistosoma japonicum (2)
Recombinant E (2)
Recombinant human PEBP1 (2)
Rice Seed (2)
SARS CoV 2 S1 (2)
Sf9 Cells (2)
Source Mouse (2)
Source Rat (2)
Source Sheep (2)
Source Xenopus (2)
Syrian Golden Hamster (2)
Tarantula (2)
This tPA is expressed in DS2 cells (2)
Tritirachium album limber gene (2)
murine (2)
sequence 385RAELNQSEEPEAGES399 (2)
synthetic peptide (2)
1 36 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (1)
199 212 peptide QEEGLHSIYSFDET (1)
3 39 ELDRICGYGTARCRKK CRSQEYRIGRCP NTYACCLRK (1)
4 41 (1)
Alpaca (1)
Ascites fluid (1)
CD4 antibody was produced in Mouse (1)
CDH1 E Cadherin antibody was produced in Goat (1)
CHO K1 Cells (1)
DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (1)
Dog (1)
E Coli BL21 DE3 (1)
E Coli derived recombinant protein (1)
E Coli or Yeast (1)
F11 FX1 Factor XI antibody was produced in Sheep (1)
HEK 293 EBNA Cell Line (1)
Host Chicken (1)
Host ChickenSource Mouse (1)
Host GoatSource Human apolipoprotein AII (1)
Host GoatSource Mouse (1)
Host GoatSource Rabbit (1)
Host MouseSource Porcine (1)
Host MouseSource Tissue Culture (1)
Host Porcine (1)
Host RabbitSource Bovine (1)
Host RabbitSource Chicken (1)
Host Rat Rattus norvegicus (1)
Host RatSource Mouse (1)
Host SheepSource Human (1)
Host SheepSource Mouse (1)
Host Species (1)
HuCAL (1)
Human E (1)
Human Homo sapiens (1)
Human recombinant E Coli (1)
Human synthetic (1)
Hybridization of P3 X63 Ag8 (1)
Hybridization of rat Y3 Ag1 (1)
ICOS CD278 antibody was produced in Rabbit (1)
Insect cell Baculovirus Source CHIKV (1)
Mou (1)
MouseSource Aequorea victoria (1)
MouseSource Bacillus anthracis (1)
MouseSource Rabbit (1)
NCAM CD56 antibody was produced in Mouse (1)
NSO Cells (1)
Nso cells (1)
PARPBP C12orf48 antibody was produced in Rabbit (1)
PTGS2 COX2 COX 2 antibody was produced in Rabbit (1)
Pepsin digest of goat anti human IgM (1)
Pig Kidney (1)
Porcine (1)
RAB54A RAB5 antibody was produced in Goat (1)
RAB7A RAB7 antibody was produced in Goat (1)
RabbitSource E Coli (1)
Rat IgG2bk (1)
Recombinant Phage Display (1)
Recombinant protein encoding human (1)
Recombinant protein expressed in Sf21 cells (1)
Reombinant Human E Coli (1)
STGSKQRSQNRSKTC C aa1 14 (1)
Sepharose Affinity Purification (1)
Source Duck (1)
Source Feline (1)
Source Mollusk (1)
Source Mouse Ascites (1)
Source Pigeon (1)
Synthetic human NPR C a (1)
Synthetic human beta Defensin 1 peptide a (1)
Synthetic human beta Defensin 2 peptide a (1)
Synthetic human beta Defensin 4 peptide a (1)
TGN46 TGN38 antibody was produced in Rabbit (1)
Texas Red Rabbit (1)
coli Full length protein P0DN86 (1)
goat (1)
pastoris (1)
Tissue
Virus
Disease
SKU
Product name
Supplier
Catalog no.
Size
Price
01025413196
Treponema pallidum TmpA, Recombinant (Syphilis)
Info
MyBioSource
MBS638247
0.1 mg
Ask
Ask
04025413196
Treponema pallidum TmpA, Recombinant (Syphilis)
Info
MyBioSource
MBS638247
5x0.1 mg
Ask
Ask
Filters
Sitemap
Contact
$
EUR
GBP
PLN
USD
Login or register
Total
products
: 2
Current
page
:
1
Go to first
Recombinant
peptide
anti
coli recombinant
Clear all
Compact list
Compact list
Extended list
Compact list
Compact list
Extended list
Sitemap
Contact
Currency: $
EUR
GBP
PLN
USD
Cart
Login or register
Contact us
Send
Close