Filters
SKU Product name Supplier Catalog no. Size Price
01025270547 Recombinant Human WNT Inhibitory Factor 1 Info MyBioSource MBS143513 0.002 mg Ask Ask
01025271287 Recombinant Human Heat Shock 70kDa protein 5, Hi-5 Info MyBioSource MBS144275 0.005 mg Ask Ask
02015327376 Beta-Defensin-1 (a.a. 1-36) Peptide[Defensin, beta-1 (a.a. 1-36), Human] Info MyBioSource MBS318035 NA Ask Ask
02025270547 Recombinant Human WNT Inhibitory Factor 1 Info MyBioSource MBS143513 0.005 mg Ask Ask
02025271287 Recombinant Human Heat Shock 70kDa protein 5, Hi-5 Info MyBioSource MBS144275 0.02 mg Ask Ask
03015270547 Recombinant Human WNT Inhibitory Factor 1[WNT Inhibitory Factor 1] Info MyBioSource MBS143513 0.01 mg Ask Ask
03015271287 Recombinant Human Heat Shock 70kDa protein 5, Hi-5[Heat Shock 70kDa protein 5] Info MyBioSource MBS144275 1 mg Ask Ask
03015389261 Vidarabine[Vidarabine] Info MyBioSource MBS577412 50 mg Ask Ask
03025270547 Recombinant Human WNT Inhibitory Factor 1 Info MyBioSource MBS143513 0.01 mg Ask Ask
03025271287 Recombinant Human Heat Shock 70kDa protein 5, Hi-5 Info MyBioSource MBS144275 1 mg Ask Ask
05025270547 Recombinant Human WNT Inhibitory Factor 1 Info MyBioSource MBS143513 5x0.01 mg Ask Ask
05025271287 Recombinant Human Heat Shock 70kDa protein 5, Hi-5 Info MyBioSource MBS144275 5x0.02 mg Ask Ask
Search
Filters
Sitemap Contact
$
  • EUR
  • GBP
  • PLN
  • USD
Total products: 12 Current page: 1  Go to first
  • R 42470

  • Hi 5 Cells

  • 1 36 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

  • Clear all
Contact us
Ajax processing
Close
Chat with gentaur.com employee