Filters
SKU Product name Supplier Catalog no. Size Price
01025410768 HDAC7, Recombinant, Human (Histone Deacetylase 7, DKFZP586J0917, HD7a) Info MyBioSource MBS635486 0.01 mg Ask Ask
01025411257 HDAC5, Recombinant, Human (HD5, FLJ90614, KIAA0600, NY-CO-9, Histone Deacetylase 5) Info MyBioSource MBS636039 0.01 mg Ask Ask
01025411314 HDAC11, Recombinant, Human (Histone Deacetylase 11) Info MyBioSource MBS636102 0.05 mg Ask Ask
01025412531 HDAC10, Recombinant, Human (Histone Deacetylase 10) Info MyBioSource MBS637492 0.05 mg Ask Ask
01025412836 HDAC9, Recombinant, Human (Histone Deacetylase 9) Info MyBioSource MBS637835 0.01 mg Ask Ask
01025412878 HDAC4, Recombinant, Human (Histone Deacetylase 4) Info MyBioSource MBS637883 0.01 mg Ask Ask
01025413165 Epidermal Growth Factor Receptor, T790M, Recombinant, Human (erbB, EGFR) Info MyBioSource MBS638210 0.01 mg Ask Ask
01035412478 HDAC1, Recombinant, Human, His-DYKDDDDK (Histone Deacetylase 1) Info MyBioSource MBS637434 0.05 mg Ask Ask
02015327376 Beta-Defensin-1 (a.a. 1-36) Peptide[Defensin, beta-1 (a.a. 1-36), Human] Info MyBioSource MBS318035 NA Ask Ask
02015410768 HDAC7, Recombinant, Human (Histone Deacetylase 7, DKFZP586J0917, HD7a)[HDAC7] Info MyBioSource MBS635486 NA Ask Ask
02015411314 HDAC11, Recombinant, Human (Histone Deacetylase 11)[HDAC11] Info MyBioSource MBS636102 NA Ask Ask
02015412478 HDAC1, Recombinant, Human, His-FLAG (Histone Deacetylase 1) [HDAC1, His-FLAG] Info MyBioSource MBS637434 NA Ask Ask
02015412531 HDAC10, Recombinant, Human (Histone Deacetylase 10)[HDAC10] Info MyBioSource MBS637492 NA Ask Ask
02015412836 HDAC9, Recombinant, Human (Histone Deacetylase 9)[HDAC9] Info MyBioSource MBS637835 NA Ask Ask
02015412878 HDAC4, Recombinant, Human (Histone Deacetylase 4)[HDAC4] Info MyBioSource MBS637883 NA Ask Ask
04025410768 HDAC7, Recombinant, Human (Histone Deacetylase 7, DKFZP586J0917, HD7a) Info MyBioSource MBS635486 5x0.01 mg Ask Ask
04025411257 HDAC5, Recombinant, Human (HD5, FLJ90614, KIAA0600, NY-CO-9, Histone Deacetylase 5) Info MyBioSource MBS636039 5x0.01 mg Ask Ask
04025411314 HDAC11, Recombinant, Human (Histone Deacetylase 11) Info MyBioSource MBS636102 5x0.05 mg Ask Ask
04025412531 HDAC10, Recombinant, Human (Histone Deacetylase 10) Info MyBioSource MBS637492 5x0.05 mg Ask Ask
04025412836 HDAC9, Recombinant, Human (Histone Deacetylase 9) Info MyBioSource MBS637835 5x0.01 mg Ask Ask
04025412878 HDAC4, Recombinant, Human (Histone Deacetylase 4) Info MyBioSource MBS637883 5x0.01 mg Ask Ask
04025413165 Epidermal Growth Factor Receptor, T790M, Recombinant, Human (erbB, EGFR) Info MyBioSource MBS638210 5x0.01 mg Ask Ask
04035412478 HDAC1, Recombinant, Human, His-DYKDDDDK (Histone Deacetylase 1) Info MyBioSource MBS637434 5x0.05 mg Ask Ask
Search
Filters
Sitemap Contact
$
  • EUR
  • GBP
  • PLN
  • USD
Total products: 25 Current page: 1  Go to first
  • Baculovirus expression system

  • Synthetic human beta Defensin 1 peptide a

  • 1 36 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

  • Clear all
Contact us
Ajax processing
Close
Chat with gentaur.com employee