gentaur logogentaur logo
x

Human Recombinant p23 Protein

  • Catalog number
    SPR-303B
  • Product name
    Human Recombinant p23 Protein
  • Size
    100 µg
  • Stock availability
    In Stock
  • Scientific context
    p23 is a highly conserved ubiquitous protein, known to have an important function as a cochaperone for the HSP90 chaperoning system (1). Studies have revealed that p23 is a small protein (18 to 25 kDa) with a simple structure (2, 3). p23 does not have any structural homology with any other known proteins (1). p23 was first discovered as a part of the HSP90-progesterone receptor complex along with HSP70, p54 and p50 (1). p23 is a phosphor-protein, which is highly acidic and has an aspartic acid-rich c-terminal domain (1). Numerous studies have found p23 to be associated with other client proteins like Fes tyrosine kinase (4), the heme regulated kinase HRI (5), hsf1 transcription factor (4), aryl hydrocarbon receptor (4), telomerase (6), and Hepadnavirus reverse transcriptase (7). In spite of several years of study, the exact functional significance of p23 is still not clear (8). p23 is thought to be involved in the adenosine triphosphate–mediated HSP90 binding of client proteins (8). Since many HSP90 client proteins are involved in oncogenic survival signaling, a recent study has concluded p23 to be a promising target in leukemic apoptosis (9). HSP90 and its co-chaperone p23 are certainly among the emerging anti-tumor targets in oncology.
  • Protein target
    p23
  • Protein reactivity
    Human
  • Certificate of analysis
    This product has been certified >90% pure using SDS PAGE analysis. 4uM SPR-303, when added to 2uM SPR-300 (Aha1)-activated HSP90 (2uM; His-tagged HSP90 beta) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100ul reaction at 37 degrees C, eliminated all Aha1-mediated ATPase stimulation as well as intrinsic HSP90 ATPase activity. (This is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm).
  • Protein description
    Human Recombinant p23 Protein
  • Other name
    Sid 3177 Protein, Co chaperone p23 Protein, cPGES Protein, HSP90 co chaperone Protein, cytosolic prostaglandin E2 synthase Protein, PTGES3 Protein, TEBP Protein
  • Primary research area
    Cancer, Heat Shock
  • Category
    Protein
  • Brand name
    none
  • Origin
    Recombinant
  • NCBI number
    NP_006592.3
  • Gene number
    10728
  • Protein number
    Q15185
  • Verified applications
    WB, SDS-PAGE, Functional Assay
  • Relevant bio activity
    p23 Protein
  • Protein expression model
    E. coli
  • Protein charasterics
    See included datasheet.
  • Peptide sequence
    SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
  • Protein purification
    Affinity Purified
  • Purity pourcentage
    >90% High purity
  • Recommended buffer for storage
    20mM HEPES buffer pH7.2, 80mM NaCl, 10% glycerol
  • Protein concentration
    Lot/batch specific. See included datasheet.
  • Protein specificity
    ~23 kDa
  • Protein tag
    No tag
  • Storage recommendations
    -20°C
  • Shipping recommendations
    Blue Ice or 4°C
  • Supplementary useful information
    Please see included datasheet or contact us
  • Protein cell localization
    Cytoplasm
  • Bibliography
    1. Johnson J.L., Beito T. G., Krco C.J. & Toft D.O. (1994) Mol Cell Biol. 14: 1956-63. 2. Weikl T., Abelmann K. & Buchner J. (1999) J Mol Biol. 293: 685-91. 3. Weaver A.J., Sullivan W.P., Felts S.J., Owen B.A. & Toft, D.O. (2000) J Biol Chem. 275: 23045-52. 4. Nair S.C., et al. (1996) Cell Stress Chaperones. 1: 237-50. 5. Xu Z., et al. (1997) Eur J Biochem. 246, 461-70. 6. Holt S.E., et al. (1999) Genes Dev. 13: 817-26. 7. Hu J., Toft D., Anselmo D. & Wang X. (2002) J Virol. 76: 269-79. 8. Felts S.J. & Toft D.O. (2003) Cell Stress Chaperones. 8: 108-13. 9. Gausdal G., Gjertsen B.T., Fladmark K.E., Demol H., Vandekerckhove J. & Doskeland S.O. (2004) Leukemia.
  • Release date
    31-Jul-2009
  • PubMed number
    Not added. Please refer to PubMed
  • Tested applications
    to be tested
  • Tested species reactivity
    to be tested
  • Representative figure
    Representative_figure
  • Representative figure legend
    SDS-PAGE of native human 23kDa p23 protein (SPR-303). SDS-Page of human p23 Protein (SPR-303)
  • Warnings
    Non-hazardous materials
  • Protein origin
    Canada
  • Total weight kg
    1.4
  • Net weight g
    0.1
  • Other related products
    Other_related_products
  • Gene target
    p23 Protein
    • Gene info
    • Identity:HGNC:9668
    • Gene:PTPRD
    • Long gene name:protein tyrosine phosphatase receptor type D
    • Synonyms:PTPDHPTP
    • Discovery year:1992-02-12
    • Entrez gene record:5789
    • Pubmed identification:7896816, 8355697
    • Classification:Protein tyrosine phosphatases receptor type, Fibronectin type III domain containing, I-set domain containing
    • VEGA ID:OTTHUMG00000021005
    Gene info
  • Gene symbol
    PTPRD, TMED10
  • Short name
    Recombinant p23 Protein
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. StressMark proteins advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec