• Catalog number
    SPR-118C
  • Product name
    Human Recombinant HSP27 Protein
  • Size
    2x100 µg
  • Stock availability
    In Stock
  • Scientific context
  • Protein target
    HSP27
  • Protein reactivity
    Human
  • Certificate of analysis
    This product has been certified >90% pure using SDS-PAGE analysis.
  • Protein description
    Human Recombinant HSP27 Full Length Protein
  • Other name
    28kDa heat shock Protein, CMT2F Protein, HSP25 Protein, HSP27 Protein, HSP28 Protein, HSPB1 Protein, SRP27 Protein
  • Primary research area
    Cancer, Heat Shock
  • Category
    Protein
  • Brand name
    none
  • Origin
    Recombinant
  • NCBI number
    BC012768
  • Gene number
    3315
  • Protein number
    P04792
  • Verified applications
    WB, SDS-PAGE, Functional Assay, ELISA
  • Relevant bio activity
    HSP27 Protein
  • Protein expression model
    E. coli
  • Protein charasterics
    Full Length
  • Peptide sequence
    MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
  • Protein purification
    Affinity Purified
  • Purity pourcentage
    >90% High purity
  • Recommended buffer for storage
    20mM Tris/HCl pH7.5, 0.45M NaCl, 10% glycerol, 5mM DTT
  • Protein concentration
    Lot/batch specific. See included datasheet.
  • Protein specificity
    ~27 kDa
  • Protein tag
    No tag
  • Storage recommendations
    -20°C
  • Shipping recommendations
    Blue Ice or 4°C
  • Supplementary useful information
    Please see included datasheet or contact us
  • Protein cell localization
    Cytoplasm, Nucleus
  • Bibliography
    1. Kim K.K., Kim R., and Kim, S. (1998) Nature 394(6693): 595-599. 2. Van Montfort R., Slingsby C., and Vierling E. (2001) Addv Protein Chem. 59: 105-56. 3. Ehrnsperger M., Graber S., Gaestel M. and Buchner J. (1997) EMBO J. 16: 221-229. 4. Ciocca D.R., Oesterreich S., Chamness G.C., McGuire W.L., and Fugua S.A. (1993) J Natl Cancer Inst. 85 (19): 1558-70. 5. Sarto C. Binnz P.A. and Mocarelli P. (2000) Electrophoresis. 21(6): 1218-26. 6. Arrigo A.P. (2005) J Cell Biochem. 94(2): 241-6.
  • Release date
    31-Aug-2009
  • PubMed number
    Not added. Please refer to PubMed
  • Tested applications
    to be tested
  • Tested species reactivity
    to be tested
  • Representative figure
  • Representative figure legend
    SDS-PAGE of 27kDa native human Hsp27 protein (SPR-118). SDS-Page of human HSP27 Protein (SPR-118)
  • Warnings
    Non-hazardous materials
  • Protein origin
    Canada
  • Total weight kg
    1.4
  • Net weight g
    0.2
  • Other related products
  • Gene target
    HSP27 Protein
  • Gene info
  • Gene symbol
    HSPB1
  • Short name
    Recombinant HSP27 Protein
  • technique filter
    • Recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. StressMark proteins advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative technique
    rec