- Catalog number70R-2872
- Product nameGlycogen Synthase 2 antibody
- Size50 µg
- PriceAsk For Price
- CategoryPrimary Antibody
- Antibody SubtypePolyclonal Antibodies, Purified
- Area of researchCell Biology
- Type of ImmunogenGlycogen Synthase 2 antibodies were raised using a synthetic peptide corresponding to a region with amino acids TLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVED
- Raised inRabbit
- Cross ReactivityHuman,Mouse,Rat
- Method of PurificationAffinity purified
- Concentration1 mg/ml
- Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GYS2 antibody in PBS
- StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Shipping conditionsBlue Ice
- Tested forWB
- Usage RecommendationsWB: 1 ug/ml
- Assay InformationGlycogen Synthase 2 Blocking Peptide, catalog no. 33R-9185, is also available for use as a blocking control in assays to test for specificity of this Glycogen Synthase 2 antibody
- Additional InformationThis is a rabbit polyclonal antibody against GYS2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
- URL
- More info
- Gene targetGlycogen Synthase 2
- Identity:HGNC:4707
- Gene:GYS2
- Long gene name:glycogen synthase 2
- Synonyms gene name:glycogen synthase 2 (liver)
- Discovery year:1993-09-24
- Entrez gene record:2998
- RefSeq identity:NM_021957
- Classification:Glycosyl transferases group 1 domain containing
- VEGA ID:OTTHUMG00000169135
- Gene symbolGYS2
- Short nameGlycogen Synthase 2 antibody
- technique filter
- Antibody
- TechniqueAntibody, antibodies against human proteins, antibodies for
- Alternative techniqueantibodies
Gene info
Locus Specific Databases:LRG_1293