Filters
Technique
Supplier
Species
Label
Isotype
Host
E Coli or Yeast or Baculovirus or Mammalian Cell (3775786)
Rabbit (835865)
mouse (506674)
Rat (317004)
Yeast (249976)
e. coli (246146)
Mouse (140242)
Assay (129139)
Goat (115682)
Rabbit Oryctolagus cuniculus (63437)
Sheep (62076)
E Coli (55474)
mouse monoclonal (36053)
Horse (32006)
Hamster (29239)
Camel (24528)
coli (17759)
Synthetic (9051)
Source Human Homo sapiens (8815)
Host Rabbit Oryctolagus cuniculus (7923)
Human (5971)
N A (5462)
Mouse Mus musculus (5287)
Synthetic peptide (4451)
chemical synthesis (3294)
Chicken (2882)
Baculovirus (2127)
Sf9 (1753)
Donkey (1395)
Baculovirus cells (1357)
HEK293 cells (1335)
Host Mouse (1243)
Host Mouse Mus musculus (1015)
Sf9 insect cells (1004)
Sf9 insect cells using baculovirus (957)
Source Ascites (926)
cho (868)
NA (818)
Host Goat (786)
CHO cells (749)
Escherichia Coli (742)
Guinea Pig (713)
Insect Cells (667)
293F cell (588)
Host MouseSource Ascites (570)
HEK 293 cells (568)
Host Mouse Source Ascites (564)
Recombinant (506)
Mouse Source Human (504)
Source Mouse Mus musculus (502)
Rat Rattus norvegicus (501)
Viral (465)
Host Sheep (453)
Host Rabbit (436)
Sf9 Insect Cells (418)
Mammalian cells (411)
Human plasma (408)
Source Sheep serum (404)
Sf9 Baculovirus Cells (398)
293 cell culture (384)
Baculovirus Insect cells (376)
Human Plasma (372)
Source Rabbit serum (368)
natural extract (330)
Host Rabbit Source Human (326)
CHO Cells (321)
Insect cells (319)
Protein conjugation (306)
recombinant (304)
Guinea pig (287)
Armenian Hamster (280)
HEk293 Cells (280)
MouseSource Human (278)
HEK293 Cells (248)
Pichia pastoris (241)
Source Zebrafish (231)
Bovine (228)
Baculovirus Sf9 insect cells (210)
E ColiSource Human (192)
Baculovirus Cells (191)
Host Rabbit Source Rat (178)
Host RabbitSource Human (167)
HEK (163)
Source Hybridoma cell culture (154)
Mouse Balb c (143)
Coli (138)
HEK 293 cellsSource Human (138)
Swine (133)
HEK 293 (128)
Pichia Pastoris (128)
Semisynthetic (123)
E Coli derived (119)
Human 293 cell expressed (119)
CHO (116)
HEK293 (116)
Host Rabbit Source Mouse (116)
Baculovirus Insect Cells (112)
Source Mouse ascites (112)
Source Rat Rattus norvegicus (103)
rabbit (103)
HEK 293 cells Source Human (100)
Chinese Hamster Ovarian Cells CHO (93)
Host Mouse Source Cell Culture (91)
Insect cell culture (91)
Host RabbitSource Rat (89)
Mouse ascites (89)
Sf9 Insect cells (89)
Syrian Hamster (88)
Baculovirus infected Sf9 cells (86)
Dog (86)
HEK 293 Cells (85)
Host Mouse Source Ascites Fluid (85)
Ag8 (83)
Sf9 cells (82)
MouseSource Ascites (79)
Streptomyces sp (79)
Hybridization of P3X63 (77)
Mouse Ascites (75)
Rabbit Source Human (74)
Human E Coli (73)
Nicotiana benthamiana (72)
Host Rat (71)
Recombinant E Coli (68)
Source Cell Culture (65)
Host RabbitSource Mouse (62)
Hybridization of P3X63 Ag8 (62)
Host MouseSource Cell Culture (61)
Multiple (61)
Guinea (58)
Mammalian Cell (58)
Mouse MAB (58)
Prokaryotic expression (58)
Source Human (57)
Host MouseSource Ascites Fluid (56)
Bovine plasma (55)
Placental villi (55)
rat (55)
Cat (54)
Hi 5 Insect cells (54)
Pig (53)
Murine (52)
Escherichia coli (50)
HEK293 cellsSource Human (49)
Insect Cell (48)
Mouse Source Ascites (47)
RabbitSource Human (46)
Insect Cell Expression System (45)
HEK 293 cellsSource Mouse (44)
HEK Cells (44)
Saccharomyces cerevisiae (44)
Human from E Coli (42)
Ascites (41)
BTI Tn 5B1 4 Hi 5 Insect cells (41)
Porcine (41)
Human serum (39)
Normal mouse serum (38)
Human Patient (37)
Source Rat ascites (37)
Human Donor (36)
Human Serum (36)
Recombinant Human (36)
Human Urine (35)
Chinese Hamster Ovary Cells CHO (33)
Human heart tissue (33)
Human Liver (32)
Hybridoma cell culture (32)
Host Mouse Source Tissue Culture (30)
Human Neutrophils (30)
Streptomyces avidinii (30)
Avian (29)
E ColiSource Mouse (29)
Host Mouse Source Human (29)
Human myeloma plasma (29)
Normal rat serum (29)
Streptomyces Avidinii (29)
Canine (28)
Mouse hybridoma (28)
RMab (28)
Sf9 Baculovirus (28)
Source Tissue Culture (28)
human E Coli (28)
E coli (27)
Myeloma serum (27)
Nicotiana benthamiana plant (27)
Recombinant Mouse (27)
cerevisiae (27)
High Quality Heparin (26)
Host MouseSource Tissue Culture (26)
Human Neutrophil (26)
Llama (26)
Source Porcine (26)
Cell Free Expression (25)
E Coli Source Human (25)
Mouse plasma (25)
MouseSource Cell Culture (25)
Myeloma Serum (25)
Pool of normal Syrian hamster sera (25)
Single Human Donor (25)
Tissue culture supernatant (25)
Baculovirus expression system (24)
Calf Thymus (24)
HeLa cells (24)
Mammalian Cells (24)
Sf21 cells (24)
HIV I and HIV II antibodies (23)
Human Pituitary Glands (23)
Human liver (23)
Source Goat serum (23)
Vero Cells (23)
293 Cell Culture (22)
Cultured in vitro (22)
Host Mouse Source Tissue Culture Supernatant (22)
Mouse Source Cell Culture (22)
Rabbit Muscle (22)
Rat plasma (22)
Armenian hamster (21)
HEK293 Human Embryonic Kidney cell line (21)
Human Seminal Fluid (21)
Human cells (21)
SF9 insect cells (21)
10 aqueous DMSO (20)
Cell Culture (20)
Chicken Eggs (20)
Host Mouse Source Culture (20)
Host MouseSource Culture (20)
Human Heart (20)
Human Myeloma Plasma (20)
Human urine (20)
Native (20)
expressed in E Coli (20)
Host MouseSource Human (19)
Human Cardiac Tissue (19)
Human Erythrocytes (19)
Human tissue (19)
Pigeon (19)
Recombinant human (19)
Saccharomyces Cerevisiae (19)
Saccharomyces cerevisae (19)
Source Rat (19)
recombinant E Coli (19)
293F Cell (18)
Allantoic fluid of 10 day old embryonated eggs (18)
Chemical (18)
Ethanolamine Salt (18)
Hi 5 cells (18)
Porcine Pancreas (18)
Human Pancreas (17)
Human placenta (17)
Porcine Heart (17)
Rabbit Mouse (17)
BaculovirusSource Human (16)
Drosophila S2 (16)
Hamster Armenian (16)
Host MouseSource Tissue Culture Supernatant (16)
Human brain (16)
Mouse IgG1 (16)
Rb (16)
Recombinant Human E Coli (16)
Turkey (16)
293 Cell Line Human Embryonic Kidney (15)
Bacterial (15)
Baculovirus in Sf9 insect cells (15)
Bovine Tissues (15)
Bovine tissues (15)
Drosophia (15)
Following ultracentrifugation (15)
HEK293 Human embryonic kidney cell line (15)
Human Pooled Serum (15)
Human Pregnancy Urine (15)
Human cell expressed (15)
Human seminal fluid (15)
Normal goat serum (15)
Pooled Human Donors (15)
Pregnant Human Donor (15)
Purified from chicken egg white (15)
Recombinant from E Coli (15)
293 cells (14)
BHK cells (14)
BTI Tn 5B1 4 Hi 5 Insect Cells (14)
BaculovirusSource Mouse (14)
Bovine Serum (14)
Calf Intestine (14)
Duck (14)
HEK cells (14)
Host Chicken Source Rat (14)
Host Goat Source Human (14)
Human 293 cells (14)
Human Platelets (14)
Mammalian Cell Expression System (14)
Peptide synthesis (14)
Purified from pooled normal mouse serum (14)
Rabbit serum (14)
Rice Grain Oryza Sativa (14)
Sf9 CELLS INSECT (14)
from human plasma (14)
Chinese hamster ovary CHO cells (13)
Equine (13)
Host Human (13)
Human Pituitary Gland (13)
Human neutrophil (13)
Human recombinant protein expressed in E Coli (13)
Human skeletal muscle (13)
Insect cell (13)
Natural extract (13)
Purified from human urine (13)
Purified from pooled normal human serum (13)
SF21 Insect cells (13)
Urine of post menopausal women (13)
Cloned from HBV 320 genome (12)
Feline (12)
HEK293E Cells (12)
HF Cells (12)
Host Chicken Source Human (12)
Host E (12)
Human recombinant from E Coli (12)
Liver Carcinoma (12)
Mammalian Cell Line (12)
Parasite (12)
Pichia (12)
Purified From HEK 293 Cell culture Supernatant (12)
Rabbit Reticulocytes (12)
Recombinant Human E coli (12)
Source Bovine (12)
Source Culture (12)
Source Rabbit plasma (12)
Very Low Density Lipoprotein VLDL (12)
Yeast or Baculovirus or Mammalian Cell (12)
Zaire ebolavirus (12)
coliSource E Coli (12)
Cell culture (11)
HEK 293 cellsSource Rabbit (11)
HEK 293 cellsSource Rat (11)
HSV 1 MacIntyre Strain (11)
Host HumanSource E Coli (11)
Human Sera (11)
Human pregnancy urine (11)
Normal rabbit serum (11)
Ostrich (11)
Pastoris (11)
Allantoic Fluid (10)
Allantoic fluid (10)
Baculovirus Sf9 Cells (10)
Baculovirus infected Silkworm (10)
CHO Cell (10)
Cattle (10)
E Coli K5 bacterial culture (10)
Egg white (10)
Goose (10)
Hi 5 Cells (10)
Host Mouse Source Cell Culture Supernatant (10)
Human Adenocarcinoma (10)
Human Adipose Tissue (10)
Human Embryonic Kidney cells (10)
Human Fluids (10)
Human Milk (10)
Human Stomach (10)
Human pituitary glands (10)
Hybridization of P3 Ag8 (10)
Hybridization of X63 (10)
Insect cell Baculovirus Source Mouse (10)
Mouse chimeric (10)
Mouse myeloma cell line (10)
Pooled normal human sera (10)
Purified from Bovine milk (10)
Purified from pooled normal goat serum (10)
Quail (10)
Rabbit plasma (10)
Rice (10)
Source Mouse (10)
insect cells (10)
Barley Endosperm Tissue (9)
Bovine Heart (9)
CHO cellsSource Human (9)
Corn (9)
Goat Serum (9)
Hansenula polymorpha (9)
HeLa Cells (9)
Hi 5 cell (9)
Honey bee (9)
Host GoatSource Human (9)
Human Cardiac Tissues (9)
Human cDNA (9)
Human heart (9)
Human myeloma serum (9)
Leishmania tarentolae (9)
Mammalian cell (9)
Murine E Coli (9)
NHDF Cells Strain AD169 (9)
NS0 (9)
NSO cells (9)
Pichia pastorisSource Human (9)
Purified from Rabbit serum (9)
Purified from pooled normal Canine serum (9)
Purified from pooled normal guinea pig serum (9)
Rice Grain (9)
S Cerevisiae (9)
Sf21 insect cells (9)
Sheep serum (9)
Tritirachium album (9)
recombinant from yeast cells (9)
synthetic peptide (9)
Amycolatopsis sp (8)
BHK Cells (8)
Baculovirus system (8)
Bovine Brain (8)
CHO K1 (8)
CHO cellsSource Mouse (8)
Calf thymus (8)
Cell culture supernatant (8)
Galanthus nivalis snowdrop bulb (8)
HEK 293 cellsSource Bundibugyo virus (8)
Heparin from Porcine Mucosa (8)
Host Chicken Source Opossum (8)
Host Mouse Source Rat (8)
Host Rabbit Source Porcine (8)
Human Blood (8)
Human Cord Serum (8)
Human cord serum (8)
Human fluids (8)
Human metastatic liver carcinoma (8)
Hybridization of Sp2 0 myelomaSource Ascites (8)
Isolated from human thyroid glands (8)
Mammalian Cell Expression System HEK293 (8)
McCoy (8)
Ms (8)
Penicillium sp (8)
Pooled normal human serum (8)
Purified from S (8)
Rat Liver (8)
Sacharomyces cerevisiae (8)
Source Canine (8)
Staphylococcus aureus (8)
Yeast cells (8)
coli recombinant (8)
expressed in E (8)
strain LGVII 434 (8)
yeast recombinant (8)
653 myeloma cells (7)
Baculovirus infected High 5 cells (7)
Bovine Kidney (7)
Bovine Liver (7)
Bovine Thymus (7)
Chinese Hamster Ovarian Cells (7)
Clostridium histolyticum (7)
E ColiSource Yeast (7)
Expressed in E Coli (7)
Genetically engineered Escherichia coli (7)
Host ChickenSource Human (7)
Host ChickenSource Rat (7)
Host Guinea pig (7)
Host MouseSource Cell Culture Supernatant (7)
Host RatSource Tissue Culture (7)
Human Cells (7)
Human Placenta (7)
Human Seminal Plasma (7)
Hybridization of Sp2 0 myeloma Source Ascites (7)
Hybridization of X63 Ag8 (7)
IgG and IgA paraproteins (7)
Insect Sf9 Cells (7)
Male mouse submaxillary glands (7)
Monkey (7)
NHDF Host Cell (7)
Normal sheep serum (7)
Plasma (7)
Porcine pancreas (7)
Potato (7)
Purified from Arachis hypogaea seed (7)
Rabbit Thymus (7)
Rat recombinant protein expressed in E Coli (7)
Recombinant E Coli strain (7)
Recombinant murine (7)
Source Guinea pig (7)
Source Rabbit Oryctolagus cuniculus (7)
Strain P3HR1 (7)
and human IgM (7)
cultured in vitro (7)
humanized antibody cultured in vitro (7)
1 myeloma cells with spleen cells from BALB c mice (6)
Artiodactyla (6)
Bacteria (6)
Bovine Pancreas (6)
Bovine pancreas (6)
CHO S Cells (6)
Chinese Hamster Ovary Cells (6)
Chinese Hamster Ovary cells (6)
Dog plasma (6)
E ColiStrain AD169 (6)
Food safety (6)
Genetically engineered E Coli (6)
Green Algae (6)
Host Goat Source Rat (6)
Host Horse (6)
Host Rabbit Source E Coli (6)
Host Rabbit Source Opossum (6)
Host Sheeep (6)
Human 293 Cells (6)
Human B Cell (6)
Human CD33 Signal Peptide (6)
Human HDL (6)
Human Mouse chimeric (6)
Human Normolipidemic Plasma (6)
Human Pleural Fluid (6)
Human breast milk (6)
Human gastric mucosa (6)
Human normolipidemic plasma (6)
Human placenta and blood (6)
Hybridization of P3 X63 Ag8 (6)
Hybridization of X63 Ag 8 (6)
Insect Cell Line (6)
Mammalian Cell Expression System CHO (6)
Mouse IgG2b (6)
Mouse Source Mouse (6)
Nasal Cartilage (6)
New Zealand Rabbit (6)
Rabbit Skeletal Muscle (6)
Rabbit thymus (6)
Rat Erythrocytes (6)
Rat Plasma (6)
Rat serum (6)
Recombinant protein from E Coli (6)
SF 9 Baculovirus (6)
Salmon (6)
Source Chicken (6)
Source Equine (6)
Source Horse serum (6)
Source Human Urine (6)
Source Human plasma (6)
Source Tissue Culture Supernatant (6)
Strain Ellen (6)
Strain producer of yeast Saccharomyces cerevisiae (6)
Streptomyces hygroscopicus (6)
Tissue culture (6)
VLDL (6)
Vero CellsStrain RH (6)
Yeast Pichia pastor (6)
adw subtype (6)
anti HBc (6)
anti HCV (6)
containing plasmid pCGA7 (6)
fresh (6)
human (6)
non frozen (6)
Adult Male Rat Submandibular Glands (5)
BHK cells Baby Hamster Kidney Cells (5)
Bacillus subtilis (5)
Baculovirus sf9 cells (5)
Baculovirus sytem (5)
Bovine Blood (5)
Bovine Lens (5)
Bovine Milk (5)
Bovine Pituitary (5)
Bovine Spinal Cord (5)
Bovine liver (5)
Bovine spinal cord (5)
CHO K1 Cells (5)
Canine Serum (5)
Cell Culture Supernatant (5)
Chicken Gizzard (5)
Chicken gizzard (5)
Dog Heart (5)
Drosophila Schneider 2 S2 cells (5)
EBV (5)
Embryonated chicken eggs (5)
Escherichia Cali (5)
Expressed in mammalian cell line (5)
Fetal calf serum FCS (5)
Fresh Human Plasma (5)
Goat Capra aegagrus hircus (5)
Goat IgG (5)
Goat serum (5)
Goat serum IgG digested with papain (5)
HCV (5)
HEK 293 cell line Human embryonic kidney (5)
HEK HumaXpress (5)
HEK Human embryonic kidney cells (5)
Hen egg white (5)
Hi 5 (5)
Hi 5 Baculovirus (5)
Hi 5 Insect Cells (5)
Hi5 cells (5)
High Five insect cells (5)
Host Mouse Source Cell culture (5)
Human Brain Tissue (5)
Human CNS (5)
Human Embryonic Kidney 293 Cells (5)
Human Embryonic Kidney 293 cells (5)
Human Embryonic Kidney HEK cells (5)
Human Fluid (5)
Human Heart Tissue (5)
Human Myeloma Serum (5)
Human Red Blood Cells (5)
Human Saliva (5)
Human Spleen (5)
Human erythrocytes red blood cells (5)
Human neutrophils (5)
Human normal serum (5)
Human pancreas (5)
Human synthetic peptide (5)
Human urine from patients with tubular proteinuria (5)
Insects expression (5)
Kidney Bean (5)
MA104 Cells (5)
Mammalian cell expression system (5)
Mammalian system (5)
Mammals (5)
Mouse BALB c (5)
Mouse Submaxillary Gland (5)
Mouse serum IgG digested with papain (5)
Mushroom (5)
Normal chicken yolk (5)
Pepsin digest of normal goat IgG (5)
Pichia pastoris co expressing NADPH Reductase (5)
Pig Liver (5)
Pooled human plasma (5)
Pooled normal mouse sera (5)
Purified from Chicken serum (5)
Purified from Horse serum (5)
Purified from Human serum (5)
Purified from Pigeon Serum (5)
Purified from Rabbit plasma (5)
Purified from Sheep serum (5)
Purified from pooled normal horse serum (5)
Purified from pooled normal porcine serum (5)
Purified from pooled normal rat serum (5)
Purified from pooled normal sheep serum (5)
Purified from the human plasma (5)
Rabbit IgG (5)
Rabbit serum IgG (5)
Rat serum IgG digested with papain (5)
Saccharomyces cerevisiae strain (5)
Spodoptera frugiperda (5)
Streptomyces avermitilis (5)
Submaxillary Gland (5)
Submaxillary Gland of Grown Mouse (5)
Synthesis (5)
Urine of pregnant women (5)
Vero Host Cell (5)
Wheat Germ (5)
coli Full Length protein P04406 (5)
coli Full length protein O15392 (5)
coli Full length protein P07306 (5)
coli Ser32 Lys333 P15529 (5)
coli Ser381 Gly683 P02788 (5)
357 (4)
A293 cells (4)
Aeromonas Proteolytica (4)
Aeromonas proteolytica (4)
Allantoic fluid of 10 days old embryonated eggs (4)
American Hamster (4)
Ascites fluid (4)
BTI Tn 5B1 4 High 5 Insect cells (4)
BTI Tn 5B1 4 High 5 insect cells (4)
Bacillus anthracis (4)
Beauveria Nlyea (4)
Bee venom (4)
Bipolaris leersia (4)
Bovine E Coli (4)
Bovine Hypothalamus (4)
Bovine Testis (4)
Bovine eye lens (4)
Bovine lung (4)
Bovine vitreous humor (4)
CHO 3E7 Cells (4)
Calf Spleen (4)
Canine Urine (4)
Cell Culture in CHO Cell Line (4)
Chicken egg white (4)
Chicken serum (4)
Chimeric (4)
Cinchona spp (4)
Clostridium difficile (4)
Corn Zea Mays (4)
Defibrinated Human Plasma (4)
Difficile Culture (4)
Difficile Toxoid from Culture (4)
Dog Serum (4)
E Coli ASI (4)
E Coli Accession Number NP_005558 (4)
E ColiSource Acidaminococcus fermentans (4)
E ColiSource Bacillus subtilis (4)
E ColiSource Geobacillus stearothermophilus (4)
E ColiSource HIV1 (4)
E ColiSource HIV2 (4)
E ColiSource HRV14 (4)
E ColiSource Japanese encephalitis Virus (4)
E ColiSource Norovirus GI (4)
E ColiSource West Nile virus (4)
E ColiSource Zika virus strain Mr 766 ZIKV (4)
E6 Host Cell (4)
E6 Virus strain MacIntyre (4)
Escherichia Colilambda lysogen NM 989 (4)
Expressed in an insect cell line (4)
Extracted from Pancreas (4)
Factor Va (4)
Fish (4)
Furze gorse seeds (4)
Goat Country of Origin USA (4)
HEK 293 cells Met1 Glu 215 (4)
HEK 293 cells Source HIV 1 (4)
HEK 293 cells Source Influenza A virus (4)
HEK 293 cells Source Mouse (4)
HEK 293 cellsSource Cynomolgus (4)
HEK 293 cellsSource Rhesus macaque (4)
HEK 293 cellsSource Zaire ebolavirus (4)
HEK293 cells Cys 32 His 430 (4)
HEK293 cells Gin 45 Ser 833 (4)
HEK293 cells Thr 25 Met 231 (4)
HEK293 cells Val 26 Gln 205 (4)
HEK293T cells (4)
HIV 1 HIV 2 by verifying (4)
HSV 2 G Strain (4)
Hamster E Coli (4)
Hansenula Polymorpha (4)
Hen s egg white (4)
Hi 5 insect cells (4)
High 5 cells (4)
Horse plasma (4)
Horse serum (4)
Host Bovine (4)
Host ChickenSource Opossum (4)
Host Hamster (4)
Host Human Neutrophil (4)
Host Mouse Source Mouse ascites (4)
Host MouseSource Rat (4)
Host Rabbit Source Drosophila (4)
Host RabbitSource Porcine (4)
Human B Cell Strain P3HR1 (4)
Human Brain (4)
Human CHO cells (4)
Human Erythrocyte (4)
Human Leukocytes (4)
Human Metastatic Liver of colon Adenocarcinoma (4)
Human Plasma HDL (4)
Human PlasmaSource Human (4)
Human cardiac tissue (4)
Human embryonic kidney cell line (4)
Human fluid (4)
Human humanized antibody (4)
Human mouse heterohybridoma (4)
Human peripheral blood T lymphocytes (4)
Human platelets (4)
Hybridization of P3x63 Ag8 (4)
Hybridization of Sp2 0 Ag14 myeloma cells (4)
Insect cellSource Mouse (4)
Jack Bean Canavalia ensiformis (4)
Llama Lama glama (4)
MRC 5 Cells Strain AD169 (4)
Mammalian cell line (4)
Mouse IgG2a (4)
Mouse Purified from ascites (4)
Mouse Source Artificial tag (4)
Mouse serum (4)
NS0 cells (4)
OPN Knockout Mouse (4)
Ovarian carcinoma cell line (4)
Peanut (4)
Pertussis Culture (4)
Pichia Pastoria (4)
Pichia pasroris (4)
Plasmin (4)
Porcine Blood (4)
Porcine Intestinal MucosaSource Porcine (4)
Porcine Mucosa (4)
Porcine kidney (4)
Porcine pituitaries (4)
Porcine plasma (4)
Purified from E Coli recombinant (4)
Purified from Human heart tissue (4)
Purified from Mouse Serum (4)
Purified from Rat serum (4)
Purified from Streptococcus hemolyticus (4)
Purified from chicken egg yolk (4)
Purified from human milk (4)
Purified from whole goat anti sera (4)
Purified frome rat serum (4)
Rabbit Source Cell Culture (4)
Rabbit Source Schistosoma japonicum (4)
Rabbit lung (4)
Rabbit muscle (4)
Rabbit or Sheep (4)
RabbitSource Cell Culture (4)
Rabbitt (4)
Rat E Coli (4)
Rat Heart Tissue (4)
Rat pancreas (4)
Recombinant Baculovirus (4)
Recombinant Human IL 8 E Coli (4)
Recombinant Human MCP E Coli (4)
Recombinant truncated HEV ORF2 (4)
Rice Flour (4)
SARS CoV 2 coronavirus (4)
Serratia marcescens gene (4)
Sf9 insect cells Baculovirus (4)
Source Human Neutrophils (4)
Source Monkey (4)
Soy Bean (4)
Soybean (4)
Staphylococcus epidermidis (4)
Tarantula (4)
Tissue Culture Sup (4)
Tritirachium album limber (4)
Two mouse hybridomas (4)
Unidentified fungus (4)
VERO Cells Strain G (4)
Wisteria floribunda seeds (4)
coli 11 179 AA Q03135 (4)
coli AA 1 165 P0DN86 (4)
coli AA 1 166 P23528 (4)
coli AA 1 188 O95445 (4)
coli AA 1 188 P01116 (4)
coli AA 101 469 P03956 (4)
coli AA 121 220 P51654 (4)
coli AA 1288 1632 P26358 (4)
coli AA 21 124 Q14508 (4)
coli AA 21 132 P01222 (4)
coli AA 210 346 P14780 (4)
coli AA 28 127 P04114 (4)
coli AA 80 400 P08727 (4)
coli AA 807 1050 P00450 (4)
coli Recombinant (4)
expressed in Hansenula polymorpha (4)
genotype 3 (4)
goat (4)
recombinant from E Coli (4)
1 myeloma cells with spleen cells from Balb c mice (3)
120 amino acids (3)
293 Cells (3)
4 Hydroxynonenal BSA (3)
653 (3)
653Source Ascites (3)
8 myeloma cells with spleen cells from BALB c mice (3)
Ag (3)
Ascites Fluid (3)
Aspergillus fumigatus (3)
Aspergillus ochraceus MST FP2005 (3)
Atropa and Datura spp (3)
Bacillus thurigiensis Bt (3)
Bacterium Streptomyces avidinii (3)
Baculovirus in Sf9 cells (3)
Baculovirus infected Bombyx Mori (3)
Baculovirus infected Sf9 (3)
Baculovirus insect cells (3)
Bee (3)
Biotinylated (3)
Black mamba (3)
Bovine Bone (3)
Bovine Red Blood cells (3)
Bovine brain (3)
Bovine kidney (3)
Bovine milk (3)
Bovine nasal cartilage (3)
Bovine serum or plasma (3)
Bovine submaxillary gland (3)
CHO Recombinant Mouse (3)
Candida albicans culture (3)
Cell CultureSource CHO Cells (3)
Chimera (3)
Chinese Hamster Ovary CHO cells (3)
Cone Snail (3)
Cyno monkey (3)
Derivative (3)
Dirofilaria immits (3)
Dog serum (3)
Donkey serum (3)
Drosophilla (3)
E Coli Expression System (3)
E Coli derived recombinant (3)
E Coli expression system (3)
E Coli full length aa1 313 (3)
E Coli lysate (3)
E ColiSource Rat (3)
E ColiSource Trichomonas vaginalis (3)
E ColiStrain IIIB (3)
EGF1 52 (3)
Elderberry bark (3)
Equine Serum (3)
ExpiCHO (3)
ExpiCHO S (3)
Freestyle 293 F cell (3)
Fusarium sp (3)
Giant keyhole limpet (3)
Goat F ab 2 IgG (3)
HEK 293 Cell Line (3)
HEK 293 cells Asp 23 Arg 227 (3)
HEK 293 cells lle 20 Glu 512 (3)
HEK 293 cellsSource Zika virus strain Mr 766 ZIKV (3)
HEK293 cells Asp 27 Leu 342 (3)
Hi 5 Insect cells BTI Tn 5B1 4 (3)
High Density Lipoprotein (3)
His tagged (3)
Host Armenian hamster (3)
Host Balb C Mouse (3)
Host C57BL6 Mouse (3)
Host CD 1 Mouse (3)
Host Confidential (3)
Host Donkey (3)
Host GoatSource Rat (3)
Host MouseSource Cell culture (3)
Host RabbitSource Drosophila (3)
Host RabbitSource E Coli (3)
Host RabbitSource Opossum (3)
Host RatSource Ascites (3)
Host Source CHO cells (3)
Human Ascites Fluid (3)
Human B Cell Host (3)
Human CD33 signal peptide (3)
Human Cell Culture (3)
Human Elastase (3)
Human GST my GST M1 1 (3)
Human Gastric Mucosa (3)
Human Mammary cell line MCF7 (3)
Human Metastatic Liver (3)
Human PLasma (3)
Human Pituitary glands (3)
Human Platelet (3)
Human Skeletal Muscle (3)
Human adenocarcinoma cell line supernatant (3)
Human cell culture supernatant (3)
Human eosinophil (3)
Human fetal cord serum (3)
Human milk (3)
Human myeloma (3)
Human pleural fluid (3)
Human recombinant (3)
Human recombinant kidney (3)
Human serum IgG digested with papain (3)
Human serum or plasma (3)
Human whole cell culture (3)
Hybridization of NS Ag (3)
Hybridization of NS Ag 4 (3)
Hybridization of NS1 Ag4 (3)
Hybridization of NS1 myeloma cell line (3)
Hybridization of NSO myeloma cell line (3)
Hybridization of P3 X63 (3)
Hybridization of P3X63Ag8 (3)
IgG1 Kappa (3)
IgG3 Kappa (3)
Insect SF21 cells baculovirus expression system (3)
Insect cell expression system (3)
Insect cells Baculovirus (3)
Isolated from human pituitary glands (3)
Legionella pneumophila culture (3)
Liver (3)
MCF 7 Cell Supernatant (3)
MCF 7 cell supernatant (3)
MDCK cellsStrain B Hong Kong 5 72 (3)
MW 21kD (3)
Megathura crenulata (3)
Met1 Gln333 (3)
Monkey serum (3)
Mouse EHS Sarcoma (3)
Mouse Serum (3)
Mouse submaxillary glands (3)
MouseSource E Coli (3)
MouseSource Mouse (3)
Murine E coli (3)
Murine ascites (3)
Murine myeloma cell line (3)
Murine pancreas (3)
Murine submaxillary glands (3)
Mycobacterium bovis BCG (3)
NP_001665 (3)
NS0 derived (3)
NS0 derived human CD45 (3)
NSO (3)
NSO Recombinant (3)
Neisseria meningitidis (3)
Neutralized pI 6 (3)
P3H3 Human Burkitt s Lymphoma cells (3)
PAI 1 from human plasma (3)
PSA Human seminal fluidACT Human plasma (3)
Pepsin digest of goat anti human IgA (3)
Pepsin digest of goat anti mouse Ig (3)
Pepsin digest of goat anti mouse IgM (3)
Pepsin digest of goat anti rat IgG (3)
Pepsin digest of normal rabbit IgG (3)
Pepsin digest of rabbit anti mouse IgG H L (3)
Plasminogen (3)
Porcine Erythrocytes (3)
Porcine Liver (3)
Porcine heart (3)
Post mortal Human Brain (3)
Postmortem human brain (3)
Prepared without using TCA (3)
Purified beta Actin from Human platelets cells (3)
Purified from Bovine Serum (3)
Purified from Bovine plasma (3)
Purified from E Coli (3)
Purified from Guinea Pig erythrocytes (3)
Purified from Human erythrocytes (3)
Purified from Human plasma (3)
Purified from Mouse erythrocytes (3)
Purified from Rabbit Serum (3)
Purified from ascites (3)
Purified from bovine heart (3)
Purified from rabbit erythrocyte (3)
Purified from sheep serum (3)
Purified from spinach leaf (3)
RAJI strain (3)
Rabbit skeletal muscle (3)
Rat Serum (3)
Rat brain mRNA (3)
Recombinant Canine (3)
Recombinant Rat (3)
Recombinant corresponding to aa1 181 of human ATF3 (3)
Recombinant expressed in E Coli (3)
Recombinant human LAG 3 produced in CHO cells (3)
Recombinant human STK10 (3)
Recombinant mouse (3)
Recombinant protein (3)
Recombinant protein E Coli (3)
Recombination (3)
Saccharomyces cereviae containing plasmid pCGA7 (3)
Salmon Testes (3)
Scorpion (3)
Serum of pregnant mares (3)
Sf21 (3)
Sf21cells (3)
Sf9 cell (3)
Shark cartilage (3)
Snake venom (3)
Source Armenian Hamster serum (3)
Source Balb C Mouse serum (3)
Source Bovine serum (3)
Source C57BL6 Mouse serum (3)
Source CD1 Mouse serum (3)
Source Donkey serum (3)
Source E (3)
Source E Coli (3)
Source Hamster (3)
Source Hamster serum (3)
Source Mouse ascites Clone Monoclonal (3)
Source Mouse serum (3)
Source Rat serum (3)
Strain FH (3)
Strain G (3)
Strain IIIB (3)
Streptomyces fradiae (3)
Streptomyces spp (3)
Supernatant of thrombin activated platelets human (3)
Synthetic peptide human (3)
Synthetic product (3)
Syrian hamster plasma (3)
Vitronectin (3)
Widespread in nature (3)
aa1 (3)
ayw subtype (3)
bacteria (3)
cerevisae (3)
deglycosylated avidin purified from egg white (3)
from plasma (3)
full length aa1 344 (3)
human Sf21 cell (3)
inoculated with Respiratory Syncytial virus (3)
kappa light chain (3)
mature nucleocapsid core protein (3)
mouse from E Coli (3)
origin (3)
produced in Pichia pastoris (3)
purified (3)
rat from E Coli (3)
recombinant protein (3)
strain Long (3)
thaliana (3)
1 VLP (2)
15 (2)
1aa 187 (2)
288 302 peptide (2)
2um (2)
653 Source Ascites (2)
653 myeloma cells with spleen cells of BALB c mice (2)
8 myeloma cells with spleen cells from Balb c mice (2)
A 19120 (2)
A 72 Cells Infected with Strain 1 71 (2)
A 72 Cells Virus Serotype 1 (2)
A 72 Cells Virus Serotype 2 (2)
A 72 cells Virus strain 1 71 (2)
A549 cell cultureStrain P (2)
AFP cell line (2)
ATCC VR 586 (2)
AY 5312 (2)
Abalone (2)
Activated rat T helper cells (2)
Adult knee cartilage (2)
Armenian hamster normal serum (2)
Aspergillus fumigatus culture (2)
Aspergillus terreus (2)
BGMK cell cultureStrain Cornelis (2)
BHK 21 Cells Virus Strain No (2)
Bacillus globigii (2)
Bacillus polymyxa (2)
Bee Venom (2)
Bipolaris sp (2)
Bordetella pertussis (2)
Bovine Calmodulin (2)
Bovine Pituitary Gland (2)
Bovine Placental villi (2)
Bovine Plasma (2)
Bovine Plasminogen (2)
Bovine RBC s (2)
Bovine articular cartilage (2)
Bovine erythrocytes (2)
Bovine gamma (2)
Bovine heart (2)
Bovine hypothalamus (2)
Bovine lens (2)
Bovine materials are of US origin (2)
Bovine placenta (2)
Bovine placenta villi (2)
Bovine recombinant protein expressed in E Coli (2)
Bovine skin (2)
Bovine spleen thymus (2)
Bovine testes (2)
Bovine thymus of US origin (2)
Bozek (2)
Broth Base Medium (2)
Broth base mediumStrain FH (2)
Broth suspensionStrain PKo (2)
CAS 276 (2)
CDC CWL 029 (2)
CHO S cell line (2)
CHX 3101 (2)
CMV Strain AD169 (2)
CRFK Cells Infected with Petaluma Strain (2)
CRFK Cells Virus strain Cornell (2)
CRFK Cells Virus strain Petaluma (2)
CRFK Cells Virus strain WSU 79 1146 (2)
CRFK cells infected with Cornell Strain (2)
CRFK cells infected with Strain Cornell (2)
Canine Pituitary Gland (2)
Canine Thyroid Gland (2)
Capsicum spp (2)
Caucasian Donor (2)
Cell Culture Proprietary Expression System (2)
Cell culture derived (2)
Chaetomium sp (2)
Chick sternal cartilage (2)
Chicken Plasmin (2)
Chicken plasma (2)
Chicken plasminogen (2)
Chilobrachys jingzhao (2)
Chinese earth tiger tarantula (2)
Coli recombinant (2)
Cord Serum (2)
Corn kernels (2)
Corynebacterium Diphtheria Culture (2)
Crab Shell (2)
Crotalus adamanteus venom (2)
Cultured in broth base medium (2)
Cultured in vivo (2)
Cyno monkey plasma (2)
Cyno monkey serum (2)
Dairy Products (2)
Defibrinated human plasma (2)
Donkey IgG (2)
E Coli BL21 (2)
E Coli RFL47 (2)
E ColiStrain C194 (2)
E ColiStrain Dumas (2)
E ColiStrain Ellen (2)
E6 Cells Strain MR 766 (2)
E6 Vero cells infected with CDV Lederle strain (2)
E6 Virus strain G (2)
E6 cells Strain New Guinea C (2)
E6 cells virus strain H 87 (2)
E6 cells virus strain H241 (2)
E6 cells virus strain Th Sman (2)
Edmonston Strain (2)
Egg White (2)
Embyonated eggs Virus strain B Jiangsu 10 03 (2)
Emericella sp (2)
Eukaryotic expression 293 F cell (2)
Extract from normal rat eye retina (2)
FC 3TG Cells (2)
FDA approved Plasma (2)
FI 6339 (2)
FRhK Cells (2)
Feline Serum (2)
Ferritin (2)
Fresh Goat Plasma (2)
Fusarium moniliforme (2)
GS 1278 (2)
Garden Pea (2)
Gastric biopsy (2)
Goat of United States origin (2)
Golden Syrian Hamster serum (2)
Grown in Vero Cells (2)
Gymnoascus reesii (2)
HDAC4 antibody was produced in a Rabbit (2)
HEK 293 Cell Culture (2)
HEK 293 cells Glu 19 Asn 250 (2)
HEK 293 cells Glu 25 Lys 418 (2)
HEK293 Cell (2)
HSV 1 Strain MacIntyre (2)
HSV 1 gD produced in Pichia pastoris (2)
HSV 2 Strain G (2)
Hamster Syrian (2)
Hamster plasma (2)
Hela cell line (2)
Helicobacter pylori (2)
Hen Egg White (2)
Hens (2)
Hep 2 Cells (2)
Hep 2 Host Cell (2)
High Purity Hormone Derivative (2)
Horse American source (2)
Horse Gram (2)
Horse Serum (2)
Host BovineSource Bovine pancreas (2)
Host Chicken Eggs (2)
Host Chicken Source Mouse (2)
Host Goat Source Mouse (2)
Host Goat Source Rabbit (2)
Host HumanSource Human plasma (2)
Host Mouse Serum (2)
Host Mouse Source Bovine (2)
Host Mouse Source Porcine (2)
Host Mouse ascites (2)
Host MouseSource Bovine (2)
Host Rabbit Source Bovine (2)
Host Rabbit Source Chicken (2)
Host Rat Source Ascites (2)
Host Rat Source Cell Culture (2)
Host Rat Source Mouse (2)
Human A431 cells (2)
Human Ascites (2)
Human Brain Hippocampus (2)
Human Cord Blood (2)
Human Embryo Lung Cell CultureStrain Ellen (2)
Human Embryo Lung cell cultureStrain Ellen (2)
Human Female Donor (2)
Human Fibroblast Cells (2)
Human Heart tissue (2)
Human IgE Myeloma Cell Line (2)
Human Plasma LDL (2)
Human Plasmin (2)
Human Pleural Ascites Fluids (2)
Human Semen (2)
Human Seminal Fluid and Human serum (2)
Human Serum Plasma (2)
Human Thyroid Tissue (2)
Human Thyroid tissue Negative for HBsAg (2)
Human cell culture (2)
Human colostrum (2)
Human erythrocytes (2)
Human fibronectin (2)
Human neutrophil granulocytes Buffy Coat (2)
Human plasma LDL (2)
Human pleural fluids (2)
Human serum Negative for HBsAg (2)
Human serum plasma (2)
Human thyroid gland (2)
Human thyroid glands (2)
Hybridization of NS 1 myeloma (2)
Hybridization of P3Ag8 (2)
Hybridization of Sp2 0 Ag 1 (2)
Hybridization of Sp2 0 Ag14 myeloma Source Ascites (2)
Hybridization of Sp2 0 myeloma (2)
Hybridization of X63 AG (2)
Hybridization of X63 Ag (2)
ICI 194660 (2)
Immunodeficient murine ascites (2)
Infected Cell Lystate (2)
Isolated from Bacillus thurigiensis Bt spores (2)
Jeryl Lynn strain (2)
Jimson Weed (2)
L Cells Virus Strain Prototype p (2)
LLC Cells Strain Abney (2)
LLC MK2 Cells (2)
LLC MK2 host cell (2)
Lancefield s Group B strain (2)
Lentil Seed (2)
M 141 (2)
MA 104 cells (2)
MDCK Cells Virus Strain D008 (2)
MDCK Cells Virus strain D004 (2)
MO 911 (2)
MRC 5 Cells (2)
MRC 5 CellsStrain AD169 (2)
MRC 5 cells Strain Adenoid 6 (2)
MRC 5 cells Virus Strain Ellen (2)
MRC 5 cellsStrain Adenoid 6 (2)
MST FP245 (2)
MW 4759 (2)
Mammalian Cell expression System HEK293 (2)
Mammalian HEK293 Cells (2)
Meat (2)
Mid brain (2)
Mixture of 4 Human Myeloma Plasmas (2)
Mouse BALB c IgG1k (2)
Mouse IgG1 myeloma cells (2)
Mouse IgM (2)
Mouse L cells Strain 434 (2)
Mouse Myeloma Ascites MOPC 21 cell line (2)
Mouse NSO 1 cells (2)
Mouse Plasmin (2)
Mouse Source Bacillus anthracis (2)
Mouse Source E Coli (2)
Mouse Source Rabbit (2)
Mouse ascites Monoclonal (2)
Mouse brain (2)
Mouse myeloma ascites TEPC 15 cell line (2)
MouseSource Artificial tag (2)
Mycoplasma pneumoniae cultureStrain FH (2)
Mycoplasma pneumoniae strain FH (2)
NCTC 10119 (2)
NDC 0082 4155 (2)
NHDF Cells (2)
NIH 3T3 Cells Virus Strain FL (2)
NSC 762 (2)
NSC 77120 (2)
Nasal cartilage (2)
Natrual (2)
Naturally (2)
Nature (2)
Neat Ascites from Mouse (2)
Normal Bovine Serum (2)
Normal Dog Serum (2)
Normal Human Brain Tissue (2)
Normal Human Serum (2)
Normal Sheep Serum (2)
Normal Sheep serum (2)
Normal human IgA (2)
Normal human IgG (2)
Normal monkey serum (2)
Normal mouse IgG (2)
Oryza sativa rice (2)
Others (2)
Ovine seminal vesicles (2)
Ovis aries Sheep (2)
P3HR 1 Cells (2)
Papain digest of goat anti human IgG (2)
Partially purified IgG fraction of rabbit serum (2)
Parvum Culture (2)
Penicillium brevicompactum (2)
Penicillium decumbens (2)
Phage Display System (2)
Phoresis Plasma (2)
Pichia pastoris co expressing NADPH Reuctase (2)
Pig Swine (2)
Plant (2)
Pneumophila Culture (2)
Pool of normal Rhesus monkey serum (2)
Pooled Defibrinated Human Serum (2)
Pooled human colostrum (2)
Pooled human retroplacental blood (2)
Pooled human serum or plasma (2)
Pooled normal feline serum (2)
Pooled normal human plasma (2)
Porcine Gall Bladder (2)
Porcine leukocytes (2)
Prepared from human serum plasma (2)
Produced from human ascites (2)
Produced in E Coli (2)
Proprietary (2)
Purified from IgG (2)
Purified from a recombinant source (2)
Purified from equine liver (2)
Purified from wheat seed (2)
Purified frome Chicken Serum (2)
Pygeum africanum (2)
QNRLLIRAREDFGVE (2)
RH Strain in Glycine Buffer (2)
RP 13057 (2)
RP 5171 (2)
Rabbit Source E Coli (2)
Rabbit Thymus from North American origin (2)
Rabbit Thymus of US origin (2)
Rabbit and bovine thymus of US origin (2)
RabbitSource Schistosoma japonicum (2)
Rat IgG2a (2)
Rat brain (2)
Rat lung (2)
Rat plasmin (2)
Rat plasminogen (2)
Rauwolfia serpentina (2)
Recombinant bovine IL 4 (2)
Recombinant human PEBP1 (2)
Rhesus monkey (2)
Rhodamine (2)
Rice Husks (2)
Rice Seed (2)
Ro 7 0207 (2)
S espinosus (2)
S variabilis (2)
SARS CoV 2 S1 (2)
SC 11800 (2)
SKF 104864A (2)
SKF 525A (2)
SM 7338 (2)
Sambucus nigra Elderberry bark (2)
Seminal fluid (2)
Septic Plasma (2)
Sf9 Cells (2)
Sheep plasma (2)
Source Cell culture (2)
Source Mouse plasma (2)
Source Normal Chicken Eggs (2)
Source Normal Mouse Serum (2)
Source Rat Serum (2)
Source Sheep (2)
Source Xenopus (2)
Staphylococcus aureus mecA (2)
Strain 385 99 New York (2)
Strain A Kiev 301 94 like Johannesburg 33 94 (2)
Strain B956 Uganda (2)
Strain Cocktail Blend (2)
Strain HPV77 (2)
Strain LGV2 (2)
Strain LV8 (2)
Strain Long (2)
Strain Texas 1 77 H3N2 (2)
Streptomyces conglobatus (2)
Streptomyces erythreus (2)
Streptomyces lincolnensis (2)
Streptomyces peucetius (2)
Streptomyces spectabilis (2)
Synthesized (2)
Synthetic human NPR B a (2)
Synthetic peptide MW 1740D (2)
Syrian Golden Hamster (2)
TWAR strain CWL 029 cultured in HL cells (2)
This tPA is expressed in DS2 cells (2)
Thrixopelma pruriens (2)
Tritirachium album limber gene (2)
U 10149 (2)
U 18409AE (2)
VR 586 (2)
VR 846 (2)
Vero Cell Culture Strain Long Strain VR 26 (2)
Vero Cells Strain Edmonston (2)
Vero CellsDengue Strain CH53489 (2)
Vero CellsDengue Strain TVP 360 (2)
Vero CellsDengue Strain West Pacific 74 (2)
Vero cell cultureStrain Adenoid 6 (2)
Vero cell cultureStrain Edmonston (2)
Vero cell cultureStrain Schmitt (2)
Vero cells (2)
Vero cells Strain 16681 (2)
Vero cells Strain Long (2)
Vero cells Virus strain C243 (2)
Vero cells Virus strain Greer (2)
Vero cells Virus strain VP1 (2)
Vero cellsStrain C243 (2)
Vero cellsStrain Greer (2)
Virus Strain HPV77 (2)
Virus strain A New Caledonia 20 99 H1N1 (2)
WIN 24540 (2)
Whole rabbit serum (2)
Whole tachyzoites (2)
Widely distributed in higher plants (2)
Widespread in plants (2)
albicans (2)
aureus (2)
bovine (2)
chicken (2)
coli PAI 1 (2)
donkey (2)
enteritidis culture (2)
followed by gel filtration (2)
from rat plasma (2)
fungi (2)
guinea pig (2)
human hepatocellular carcinoma (2)
inoculated with Adenovirus (2)
inoculated with Influenza A virus (2)
murine (2)
native (2)
normal serum (2)
paratyphi A culture (2)
paratyphi B culture (2)
pylori Strain 43504 (2)
pylori Strain 49503 (2)
pylori isolate (2)
sequence 14AQMSEDNHLSNTVRSQNDNR33 (2)
sequence 385RAELNQSEEPEAGES399 (2)
strain SA 11 (2)
strain Tonsil 99 (2)
type 6 (2)
typhi culture (2)
typhimurium culture (2)
059 27 (1)
1 36 DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (1)
1 myeloma cells with spleen cell from Lewis rat (1)
100 Swiss Mouse (1)
1162 F (1)
1314 TH (1)
14 myeloma cells with spleen cells of BALB c mice (1)
1489 RB (1)
16842 (1)
199 212 peptide QEEGLHSIYSFDET (1)
2 5410 3A (1)
2 PAM (1)
2 um (1)
27 400 (1)
28 muM (1)
3 39 ELDRICGYGTARCRKK CRSQEYRIGRCP NTYACCLRK (1)
3 MS (1)
33006 (1)
33355 (1)
37231 (1)
38489 (1)
4 41 (1)
4 C 32 (1)
4 trihydroxyethyl ether (1)
400045 (1)
41071 (1)
41982 BP (1)
42202 (1)
4MP (1)
5 ASA (1)
5058 (1)
5071 (1)
53 32C (1)
53858 (1)
6 DI t BUTYL 4 METHYLPHENOL (1)
6063 (1)
64716 (1)
653 myeloma with spleen cells of Balb c mice (1)
67314 (1)
68618 (1)
6S3 (1)
7 Cells (1)
8088 CB (1)
A 145 (1)
A 35957 (1)
A 4020 (1)
A 4166 (1)
A 5283 (1)
A 65006 (1)
A 73001 (1)
AA 2414 (1)
AA 673 (1)
ABC 12 3 (1)
ABOB (1)
ABT 335 (1)
AC 1198 (1)
AF 1160 (1)
AF 1890 (1)
AF 864 (1)
AG 1749 (1)
AG EE 623 ZW (1)
AGN 1135 (1)
AH 5158A (1)
AHR 3070C (1)
AHR 619 (1)
AHR 857 (1)
AL 1241 (1)
AL 4682 (1)
ALK3 BMPR1A antibody was produced in Mouse (1)
ALO 1401 02 (1)
AM 1155 (1)
AMRINONE (1)
AOC3 VAP 1 antibody was produced in Goat (1)
APM (1)
ASL 601 (1)
AT 4140 (1)
AT 877 (1)
AT2266 (1)
ATCC 42202 (1)
ATCC 43504 (1)
ATCC VR 185 (1)
ATCC VR 24 (1)
ATCC VR 28 (1)
ATCC VR 538 (1)
ATTC strain 49503 (1)
AW 105 843 (1)
AXL antibody was produced in Mouse (1)
AY 24234 (1)
AY 27255 (1)
AY 61123 (1)
AY 64043 (1)
AZL O 211089 (1)
AZT (1)
Abbott 22370 (1)
Abbott 44090 (1)
Abbott 50192 (1)
Abbott 64077 (1)
Abbott 84538 (1)
Acacia spp (1)
Acanthamoeba castellanii (1)
Acetobacter pasteurianus (1)
Acinetobacter lwoffi RFL21 (1)
Acinetobacter lwoffi RFL26 (1)
Acokanthera and Strophanthus spp (1)
Acremonium sp (1)
Actinomadura sp (1)
Actinoplanes spp (1)
Actinoplanes teichomyceticus (1)
Actrinomadura sp (1)
Adenovirus 41 (1)
Adenovirus Type 5 Hexon (1)
Adenovirus humano 1 (1)
Adult (1)
Aerobacter aerogenes (1)
Aesculus hippocastanum (1)
African American Human Donor (1)
Allantoic fluid of chicken eggs (1)
Allergan 211 (1)
Aloe (1)
Alpaca (1)
Ammi visnaga Lam (1)
Amni visnaga (1)
Amylase alpha (1)
Anise (1)
Antibiotic LL Z1640 2 (1)
Antibiotic LL Z1640 4 (1)
Antithrombin (1)
Apo CI is purified from delipidated VLDL (1)
Apo CIII is purified from delipidated VLDL (1)
Apolipoprotein A II was produced in Rabbit (1)
Artemisia annua (1)
Arthrobacter luteus (1)
Asian Donor (1)
Aspergillus Fumigatus (1)
Aspergillus candidus MST FP2029 (1)
Aspergillus niger (1)
Aspergillus oryzae (1)
Aspergillus orzyae (1)
Aspergillus versicolor (1)
Asplenium and Juglans spp (1)
Astra 1512 (1)
Avian pigment (1)
B 360 (1)
B 7 (1)
B31 strain (1)
BA 33112 (1)
BAQD 10 (1)
BAX 1400Z (1)
BAY 2353 (1)
BAY 39007 (1)
BAY 59 7939 (1)
BAY 9010 (1)
BAY H 4502 (1)
BC 105 (1)
BDH 1298 (1)
BGMK cells (1)
BI 1356 (1)
BIBR 1048 (1)
BIRG 0587 (1)
BL 139 (1)
BL 191 (1)
BL 4162a (1)
BM 15075 (1)
BM 210955 (1)
BMS 181158 (1)
BMS 186295 (1)
BMS 206584 01 (1)
BMS 354825 03 (1)
BMS 477118 (1)
BMY 27857 (1)
BMY 28142 (1)
BRL 1621 (1)
BRL 2064 (1)
BRL 2288 (1)
BRL 39123 (1)
BRL 42810 (1)
BRL 43694A (1)
BRL 4910A (1)
BS 572 (1)
BS 749 (1)
BTS 18322 (1)
BU (1)
BW 256 U 87 (1)
BW 33A (1)
BW 430C (1)
BW 57 322 (1)
BW 72U (1)
BW 759U (1)
BW A509U (1)
BY 1023 (1)
Ba 34276 (1)
Ba 41166 E (1)
BaCillus stearothermophilus RFL 1434 (1)
Bacillus amyloliquefaciens H (1)
Bacillus caldolyticus (1)
Bacillus centrosporus RFL1 (1)
Bacillus cereus (1)
Bacillus coagulans VS 29 022 (1)
Bacillus firmus Auk (1)
Bacillus firmus S8 336 (1)
Bacillus licheniformis (1)
Bacillus licheniformis and B subtilis (1)
Bacillus megaterium RFL1390 (1)
Bacillus megaterium RFL68 (1)
Bacillus polymyxa colistinus (1)
Bacillus pumilus RFL1102 (1)
Bacillus species N (1)
Bacillus species RFL119 (1)
Bacillus species RFL1265I (1)
Bacillus species RFL143 (1)
Bacillus species RJ3 212 (1)
Bacillus species d1 34 (1)
Bacillus sphaericus Jo 22 024 (1)
Bacillus sphaericus RFL1236 (1)
Bacillus sphaericus RFL1285 (1)
Bacillus sphaericus Tk 4 5 (1)
Bacillus stearothermophilus RFL1107 (1)
Bacillus stearothermophilus X (1)
Bacillus sterothermophilus RFL1407 (1)
Bacillus subtilis 15 (1)
Bacillus subtilis R (1)
Bacillus subtilis RFL120 (1)
Bacilus pumilus (1)
Bafilomycin D (1)
Barley (1)
Bartonella henselae (1)
Bartonella quintana (1)
Bay 5097 (1)
Bay 5360 (1)
Bay A 173 (1)
Bay E9736 (1)
Bay M1099 (1)
Bay Vi 9142 (1)
Bayer L 1359 (1)
Bear bile (1)
Berberis and Mahonia spp (1)
Bergenia spp (1)
Biotin conjugated chemically in vitro (1)
Bjerkandera adusta (1)
Borage Oil (1)
Bordetella holmesii (1)
Bordetella parapertussis (1)
Borrelia afzelii (1)
Borrelia burgdorferi (1)
Borrelia garinii (1)
Bovine Achilles Tendon (1)
Bovine Cardiac Myoglobin (1)
Bovine Chymotrypsin (1)
Bovine Hyaluronidase (1)
Bovine Myocardium (1)
Bovine Placenta (1)
Bovine and rabbit tissues (1)
Bovine blood (1)
Bovine bone (1)
Bovine colostrum (1)
Bovine lung membrane (1)
Bovine spleen (1)
Bovine sternal cartilage (1)
Bovine thymus (1)
Bovine thymus tissue (1)
Bovine tissue (1)
Bovine tissue thymus (1)
Breadfruit (1)
Brevibacterium oxydans Iti 12 052 (1)
Brucella abortus (1)
C 238 (1)
C 5 and D 1 ex Bacillus brevis (1)
CB 313 (1)
CB 337 (1)
CCI 18781 (1)
CCI 4725 (1)
CD 271 (1)
CD4 antibody was produced in Mouse (1)
CDH1 E Cadherin antibody was produced in Goat (1)
CDKN2A p16INK4a antibody was produced in a Rabbit (1)
CFTR antibody was produced in Rabbit (1)
CGA 72662 (1)
CGP 2175E (1)
CGP 32349 (1)
CH 3565 (1)
CHEMR23 CMKR1 antibody was produced in Rabbit (1)
CHO cell line (1)
CHO cells tPA (1)
CHO dhfr (1)
CHX 3311 (1)
CHX 3673 (1)
CI (1)
CI 1008 (1)
CI 23860 (1)
CI 366 (1)
CI 440 (1)
CI 473 (1)
CI 906 (1)
CI 919 (1)
CI 928 (1)
CI 945 (1)
CI 978 (1)
CJ 91B (1)
CL 12625 (1)
CL 227193 (1)
CL 232315 (1)
CL 297939 (1)
CL 301423 (1)
CL 399 (1)
CL 40881 (1)
CL 65366 (1)
CL 71563 (1)
CL 82204 (1)
CL 871 (1)
CL 983 (1)
CMT (1)
CN 10395 (1)
CN 27554 (1)
CN 35355 (1)
CO 1 (1)
CP 10188 (1)
CP 10423 16 (1)
CP 1044 J3 (1)
CP 12009 (1)
CP 12299 1 (1)
CP 12574 (1)
CP 14445 16 (1)
CP 15 639 2 (1)
CP 16171 (1)
CP 16533 1 (1)
CP 28720 (1)
CP 45899 (1)
CP 52640 2 (1)
CP 556S (1)
CP 88 (1)
CRFK Cells Virus Strain Cornell (1)
CRFK Cells Virus Strain Cornell 780916 115 (1)
CS 443 (1)
CS 500 (1)
CS 600 (1)
CS 866 (1)
CSAG 144 (1)
CT 535 18 (1)
CV 11974 (1)
CV 4093 (1)
CVT 303 (1)
Cacodylate (1)
Calf spleen (1)
Campylobacter jejuni (1)
Campylobacter jejuni culture 33291 (1)
Campylobacter jejuni cultureATCC 33291 (1)
Candida albicans (1)
Candida auris (1)
Candida rugosa (1)
Canine Cardiac Myoglobin (1)
Canine heart (1)
Canine thyroid gland (1)
Capture Rabbit (1)
Carbonic anhydrase from bovine erythrocytes (1)
Cardiotonic Digitalis lanata (1)
Caseobacter polymorphus (1)
Cassia Rheum spp (1)
Cercosporamide (1)
Cerevisiae (1)
Ceruloplasmin (1)
Chicken Egg White (1)
Chicken Intestine (1)
Chicken brain (1)
Chicken egg ovalbumin (1)
Chicken erythrocytes (1)
Chicken red blood cells (1)
Chlamydia trachomatis (1)
Chlamydophila pneumoniae (1)
Chlamydophila psittaci (1)
Cinchona bark (1)
Cinnamomum camphora (1)
Citrated Source Plasma Fresh (1)
Citromycetin (1)
Citrus aurantium (1)
Citrus oils (1)
Cl 583 (1)
Cladosporium cladosporioides (1)
Claviceps purpurea (1)
Clone H10 (1)
Coal tar (1)
Coccidioides immitis (1)
Comamonas acidovorans Lti 19 021 (1)
Common animal sterol (1)
Common in plant essential oils (1)
Compactin (1)
Complement C3 antibody was produced in Goat (1)
Consented human donors (1)
Corydalis cava and Papaver spp (1)
Corynebacterium species RFL6 (1)
Coumarouna odorata (1)
Coxiella burnetii (1)
Cryptococcus neoformans (1)
Cryptosporidium parvum (1)
Culture (1)
Cultured in Broth base medium (1)
Cyclosporin C from Trichoderma sp (1)
Cyclosporin D from Trichoderma sp (1)
Cyclosporin H from Trichoderma sp (1)
Cystatin C (1)
Cytidine 5 diphosphocholine (1)
Cytokeratin AE1 AE3 antibody was produced in Mouse (1)
Cytomegalovirus (1)
D 18506 (1)
D 2083 (1)
D 365 (1)
D 47 (1)
D 50 (1)
D 860 (1)
DETF (1)
DH 581 (1)
DJ 1550 (1)
DJN 608 (1)
DL 458 IT (1)
DMO (1)
DPN (1)
DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP (1)
DR 3355 (1)
DTPA (1)
DU 21220 (1)
DU 23000 (1)
Dactylium dendroides (1)
Dalbergia volubilis (1)
Deinococcus radiophilus (1)
Deoxybrevianamide E (1)
Derivative of cholic acid (1)
Derivative of hydrastine 01501009 (1)
Detection Chicken (1)
Digitalis lanata (1)
Digitalis spp (1)
Digoxin BSA (1)
Dirofilaria immitis (1)
Dolichos biflorus Horse Gram (1)
Dowco 179 (1)
Drosophila (1)
Drug Free Human Donors (1)
Duck serum (1)
E 955 (1)
E Coli BL21 DE3 (1)
E Coli CM 5199 (1)
E Coli MRE 600 cells (1)
E Coli derived recombinant protein (1)
E Coli infected with T4 phage (1)
E Coli or Yeast (1)
E Coli strain K12 (1)
E6 Cells Lederle (1)
EBV VCA cell line (1)
EE3 ME (1)
EHS Sarcoma (1)
EL 737 (1)
EL 857 (1)
EL 970 (1)
EMD 33512 (1)
EN 15304 (1)
EN 1639A (1)
EN 1733A (1)
ENA 713 (1)
ENT 14250 (1)
ENT 27165 (1)
ENT 27311 (1)
EU 1806 (1)
EX 4355 (1)
EXD (1)
EXP 126 (1)
Edmonston strain (1)
Eggs (1)
Embryonated Chicken Eggs (1)
Embryonic chicken brain (1)
Engelbreth Holm Swarm mouse tumor (1)
Enniatin A (1)
Enniatin A1 (1)
Enniatin B (1)
Enniatin B1 (1)
Enterobacter amnigenus RFL1104 (1)
Enterobacter cloacae RFL136 (1)
Enterocin from Streptomyces sp (1)
Enterococcus faecalis (1)
Enterococcus faecium (1)
Eprinomectin from Semi synthetic (1)
Erythrocyte lysates (1)
Escherichia coli 0157 H7 (1)
Eucalyptus and Lavender Oils (1)
Eupatorium pauciflorum (1)
F 440 (1)
F11 FX1 Factor XI antibody was produced in Sheep (1)
FAT 75634 (1)
FB 5097 (1)
FC 1157a (1)
FK 482 (1)
FLC 1374 (1)
FOXA2 antibody was produced in Goat (1)
FPL 670 (1)
FRhK 4 Cells (1)
FUDR (1)
Factor XII knockout mouse (1)
Feline Cat (1)
Feline Urine (1)
Female Human Donor (1)
Fennel and Other plant oils (1)
Fibrinogen (1)
Fibrinogen from human plasma (1)
Firefly (1)
Fish Liver Oils (1)
Fish Oils (1)
Francisella tularensis (1)
Free PSA (1)
Fresh frozen plasma (1)
Fresh goat plasma (1)
Fruits of Sorbus and Crataegus spp (1)
Fungal (1)
Fungus Fusicoccum Amygdali (1)
Fusarium equiseti (1)
Fusarium spp (1)
Fusidium spp (1)
G 24480 (1)
G 30320 (1)
G 33182 (1)
G 34586 (1)
G 35020 (1)
G 4 (1)
G25766 (1)
GER 11 (1)
GF 196960 (1)
GOE 3450 (1)
GP 45840 (1)
GP 47680 (1)
GR 109714X (1)
GR 2 925 (1)
GR 38032 (1)
GR 43175 (1)
GS 2989 (1)
GT 31 104 (1)
Galanthus (1)
Gardnerella vaginalis (1)
Geldanamycin (1)
Giardia intestinalis (1)
Goat Fibronectin (1)
Golden Syrian hamster (1)
Gramicidin A 87 (1)
Greer strain (1)
Griffonia simlicifolia (1)
Grown in FRhK 4 Cells (1)
Grown in Human Fibroblast Cells (1)
Grown in MA 104 Cells (1)
H 154 82 (1)
H 168 68 (1)
H 365 (1)
HA 1077 (1)
HB 419 (1)
HC 1528 (1)
HC 20511 (1)
HCV E1 expressed in E Coli (1)
HCV E2 expressed in E Coli (1)
HDPC (1)
HEK 293 EBNA Cell Line (1)
HHV 6 (1)
HHV 8 (1)
HMOX1 HO 1 antibody was produced in Rabbit (1)
HOE 095K (1)
HOE 296 (1)
HOE 498 (1)
HOE 760 (1)
HPEK 1 (1)
HSV (1)
HTF 919 (1)
HWA 486 (1)
Haemophilus ducreyi (1)
Haemophilus influenzae (1)
Haemophilus influenzae Rd (1)
HeLa Tachyzoites (1)
Helicobacter pylori culture (1)
Herpes simplex 1 (1)
Herpes simplex 2 (1)
Hoe 881V (1)
Hong Kong 5 72 (1)
Horse Equine (1)
Horseradish roots (1)
Host BovineSource Bovine cardiac tissue (1)
Host CanineSource Dog cardiac tissue (1)
Host Chicken (1)
Host Chicken Source Normal Chicken Serum (1)
Host ChickenSource Mouse (1)
Host ChickenSource Normal Chicken Serum (1)
Host Cyno monkeySource Cyno monkey serum (1)
Host Goat Source Human apolipoprotein AII (1)
Host Goat Source serum (1)
Host GoatSource Human apolipoprotein AII (1)
Host GoatSource Mouse (1)
Host GoatSource Rabbit (1)
Host HamsterSource Multiple (1)
Host Human Eosinophil (1)
Host Human Heart (1)
Host Human MyelomaSource Human Myeloma Plasma (1)
Host Human Pituitary (1)
Host Human PlasmaSource Pooled human plasma (1)
Host HumanSource Human adenocarcinoma (1)
Host HumanSource Multiple (1)
Host Mouse Serum Source Normal mouse serum (1)
Host MouseSource Multiple (1)
Host MouseSource Porcine (1)
Host PigSource Porcine gastric mucosa (1)
Host Porcine (1)
Host Porcine Stomach (1)
Host PorcineSource Pig cardiac tissue (1)
Host PorcineSource Porcine gastric mucosa (1)
Host RabbitSource Bovine (1)
Host RabbitSource Chicken (1)
Host Rat Rattus norvegicus (1)
Host Rat Source Tissue Culture Supernatant (1)
Host RatSource Cell Culture (1)
Host RatSource Cell Culture Supernatant (1)
Host RatSource Mouse (1)
Host RatSource Tissue Culture Supernatant (1)
Host Rhesus monkey (1)
Host Sheep Source Mouse (1)
Host SheepSource Human (1)
Host SheepSource Mouse (1)
Host Species (1)
Host Syrian HamsterSource Tissue Culture (1)
HuCAL (1)
Human 293 Cells HEK293 (1)
Human BTA cell line supernatant (1)
Human Brain tTssue (1)
Human C Reactive Protein (1)
Human CA19 9 Cancer Antigen (1)
Human Carcinoma A431 Cells (1)
Human D Dimer (1)
Human Donor Liver (1)
Human E (1)
Human Embryonic Kidney Cells (1)
Human Eosinophils (1)
Human Epididymis Cell Line Supernatant (1)
Human Eryhtrocytes (1)
Human Erythrocytes Red Blood Cells (1)
Human Factor XI (1)
Human Ferritin from human liver (1)
Human Fibrin Degradation Product X (1)
Human Fibrinogen (1)
Human Homo sapiens (1)
Human Liver Carcinoma (1)
Human Lung (1)
Human Myeloma (1)
Human Myeloma IgE from plasma (1)
Human Myeloma plasma (1)
Human Newborn Child (1)
Human Plasma from US donors (1)
Human adenocarcinoma (1)
Human adult knee cartilage (1)
Human albumin protein purified by HPLC (1)
Human ascites fluid from tumors (1)
Human bile (1)
Human blood (1)
Human cardiac muscle (1)
Human cardiac tissues (1)
Human cell line U251 (1)
Human donors (1)
Human eosinophils (1)
Human erythrocyte (1)
Human erythrocyte lysates (1)
Human foreskin keratinocytes (1)
Human hemoglobin (1)
Human liver metastasis of colon adenocarcinoma (1)
Human liver tissue (1)
Human lung (1)
Human metastatic liver (1)
Human ovarian carcinoma (1)
Human ovary tissue (1)
Human pancreatic tissue (1)
Human pancreatic tumor fluids (1)
Human plasma fresh frozen (1)
Human recombinant E Coli (1)
Human spleen (1)
Human spleen ferritin (1)
Human sputum (1)
Human sternal cartilage (1)
Human synthetic (1)
Human tPA (1)
Human thyroid (1)
Human tumor cells (1)
Humicola Fuscoatra (1)
Hybridization of J558Lmouse myeloma cells (1)
Hybridization of NOS myeloma cell line (1)
Hybridization of P3 63X Ag8 (1)
Hybridization of P3 X63 Ag 8 (1)
Hybridization of P3U1 myeloma Hamster lymphocytes (1)
Hybridization of P3X63 Ag 8 (1)
Hybridization of P3X63 AgS (1)
Hybridization of S194 5 (1)
Hybridization of Sp2 0 Ag 14 Source Ascites (1)
Hybridization of Sp2 0 Ag 14Source Ascites (1)
Hybridization of Sp2 0 Ag14 myelomaSource Ascites (1)
Hybridization of Sp2 0myeloma Source Ascites (1)
Hybridization of Sp2 0myelomaSource Ascites (1)
Hybridization of Sp2 O Ag (1)
Hybridization of X ICR F1 myeloma Source Ascites (1)
Hybridization of X ICR F1 myelomaSource Ascites (1)
Hybridization of rat Y3 Ag1 (1)
Hybridization ofP3X63 Ag8 (1)
IBMX (1)
IC 351 (1)
ICI 204636 (1)
ICI 28257 (1)
ICI 45520 (1)
ICI D1033 (1)
ICOS CD278 antibody was produced in Rabbit (1)
IL 10 antibody was produced in Rat (1)
IL23A IL 23 P19 antibody was produced in Rabbit (1)
ITGAL CD11a antibody was produced in Rabbit (1)
Inactivated (1)
Inactivated adenovirus type 11 (1)
Inactivated adenovirus type 5 (1)
Indanomycin from Streptomyces sp (1)
Induced DLD 1 Cells (1)
Induced RAW 264 (1)
Infected testicular rabbit tissue (1)
Insect cell Baculovirus Source CHIKV (1)
Insect cell culture tPA (1)
Insect cell lysate (1)
Insect cells E Coli (1)
Insect galls (1)
Insecticidal (1)
Irradiation of ergosterol (1)
Isolated from human fibroblasts (1)
JB 8181 (1)
Jack Beans Canavalis ensiformis (1)
Jackfruit (1)
K 4024 (1)
K 4274 (1)
K salt (1)
KIN 493 (1)
KT 611 (1)
KW 110 (1)
KWD 2019 (1)
Kallikrein (1)
Karenia brevis (1)
Klebsiella pneumoniae (1)
Ko 1173 (1)
Kribbella sp (1)
L 1 (1)
L 2214 (1)
L 5103 (1)
L 669455 (1)
L 67 (1)
L isomer spectrum (1)
LB 46 (1)
LL37 Cathelicidin antibody was produced in Rabbit (1)
LM 94 (1)
LS 121 (1)
LS 519 CL2 (1)
LU26 054 0 (1)
LY 139037 (1)
LY 139603 (1)
LY 156758 (1)
LY 177370 (1)
LY 237216 (1)
LY 248686 (1)
LYO 31537 (1)
Lactoferrin (1)
Lancefield s Group A strain (1)
Latrunculia Magnifica (1)
Lechevalieria sp (1)
Lederle (1)
Legionella pneumophila (1)
Leishmania chagasi (1)
Leishmania infantum (1)
Lens culinaris Lentil Seed (1)
Lens esculenta (1)
Lepidium sativum and other Cruciferae (1)
Leuconoctoc mesenteroides (1)
Leuconostoc mesenteroides (1)
Leukocytes from donor s blood (1)
Leukocytes of purulent human sputum (1)
Lima Bean (1)
Listeria monocytogenes (1)
Long strain (1)
Lupinus spp and other Leguminosae (1)
Lysobacter (1)
M B 15497 (1)
M B 693 (1)
M B 9302 (1)
M II (1)
M33 strain (1)
MBBT (1)
MCI 186 (1)
MDA modified human albumin protein (1)
MDCK Cells (1)
MDL 16455A (1)
MDL 458 (1)
MDL 507 (1)
MDL 71754 (1)
MJ 10061 (1)
MJ 1999 (1)
MJ 4309 1 (1)
MJF 12637 (1)
MJF 9325 (1)
MK 0431 (1)
MK 0462 (1)
MK 0966 (1)
MK 130 (1)
MK 208 (1)
MK 233 (1)
MK 240 (1)
MK 360 (1)
MK 366 (1)
MK 401 (1)
MK 476 (1)
MK 733 (1)
MK 906 (1)
MK 956 (1)
ML 236B (1)
MLH1 antibody was produced in Mouse (1)
MLN 518 (1)
MMab (1)
MOUSE (1)
MP 12 (1)
MPO Myeloperoxidase antibody was produced in Mouse (1)
MS 932 (1)
MST 117594 (1)
MST AS4274 (1)
MST AS4458 (1)
MST AS5338 (1)
MST AS5567 (1)
MST AS5763 (1)
MST AS5822 (1)
MST AS5883 (1)
MST FP1765 (1)
MST FP1889 (1)
MST FP2038 (1)
MST FP2115A (1)
Maackia amurensis MAA (1)
MacIntyre E6 (1)
Male Human Donor (1)
Mamalian feces (1)
Mamallian Male Hormone (1)
Mammalian Hormone (1)
Many plants (1)
Mare (1)
Marine Sponge Theonella Swinhoei (1)
Maus (1)
McN 485 (1)
McN A 28833 109 (1)
McN JR 8299 11 (1)
Measles virus (1)
Meat extracts (1)
Mentha piperita and other Mentha spp (1)
Metabolite in muscle and urine (1)
Metastatic liver carcinoma (1)
Methylobacterium species Dd 5 732 (1)
Microcccus luteus (1)
Micrococcus luteus Ng 16 122 (1)
Micrococcus varians RFL1269 (1)
Micromonospora myoensis (1)
Micromonospora spp (1)
Milk (1)
Mixture of anthranol glycosides ex Cascara sagrada (1)
Monensin A from Streptomyces sp (1)
Monkey sternal cartilage (1)
Moraxella bovis (1)
Moraxella bovis Fr 1 022 (1)
Moraxella catarrhalis (1)
Moraxella phenylpyruvica RFL1103 (1)
Mou (1)
Mouse EHS sarcoma (1)
Mouse Fibrinogen (1)
Mouse Hybridization of NS 1 myeloma (1)
Mouse Plasma (1)
Mouse Source Cell Culture CHO Cells (1)
Mouse kidney (1)
Mouse myeloma ascites TEPC 183 cell line (1)
Mouse pancreas (1)
Mouse sternal cartilage (1)
Mouse submaxillary gland (1)
MouseSource Aequorea victoria (1)
MouseSource Bacillus anthracis (1)
MouseSource Cell Culture CHO Cells (1)
MouseSource Rabbit (1)
Mumps Enders (1)
Murine cells (1)
Mycelia sterilia fungus (1)
Mycobacterium avium (1)
Mycobacterium intracellulare (1)
Mycobacterium kansasii (1)
Mycobacterium tuberculosis (1)
Mycobacterium ulcerans (1)
Mycoplasma genitalium (1)
Mycoplasma hominis (1)
Mycoplasma pneumoniae (1)
N 714 (1)
NAD (1)
NAT 333 (1)
NC 150 (1)
NC 503 (1)
NCAM CD56 antibody was produced in Mouse (1)
NCS 406087 (1)
ND 50 (1)
NDR 5998A (1)
NE 58095 (1)
NF 180 (1)
NF 260 (1)
NFS 1776 (1)
NND 1962 (1)
NSC 10023 (1)
NSC 107680 (1)
NSC 109724 (1)
NSC 113926 (1)
NSC 123127 (1)
NSC 141046 (1)
NSC 157658 (1)
NSC 158567 (1)
NSC 2101 (1)
NSC 25855 (1)
NSC 26386 (1)
NSC 27640 (1)
NSC 312887 (1)
NSC 32065 (1)
NSC 3590 (1)
NSC 405124 (1)
NSC 49171 (1)
NSC 5085 (1)
NSC 56769 (1)
NSC 60584 (1)
NSC 60719 (1)
NSC 6091 (1)
NSC 63278 (1)
NSC 6396 (1)
NSC 64198 (1)
NSC 675 (1)
NSC 67574 (1)
NSC 746 (1)
NSC 763 (1)
NSC 77370 (1)
NSC 7778 (1)
NSC 78502 (1)
NSC 9120 (1)
NSC 92338 (1)
NSC 9565 (1)
NSC 9704 (1)
NSO Cells (1)
NY 198 (1)
Narcissus and other Lillaceae (1)
Native Protein S (1)
Native glutamic pyruvate transaminase (1)
Native inactivated mumps virus (1)
Neisseria denitrificans (1)
Neisseria gonorrhoeae (1)
Nematoloma frowardii (1)
Never Frozen (1)
New Zealand Rabbits (1)
Nicotiana tabacum (1)
Nocardia corallina (1)
Nocardiopsis sp (1)
Nonactin from Strepomyces griseus (1)
Normal Chicken Serum (1)
Normal Goat Serum (1)
Normal Pancreas (1)
Normal bovine serum (1)
Normal human plasma (1)
Normal rhesus monkey serum (1)
Novobiocin from Stretomyces sp (1)
Nso cells (1)
OPC 1085 (1)
OPC 13013 (1)
OPC 7251 (1)
ORG GB 94 (1)
ORG NC 45 (1)
Orientia tsutsugamushi (1)
Ovalbumin DNP (1)
Ovine (1)
Ovine Placenta (1)
Ovine placenta (1)
Oyster (1)
P 1011 (1)
P 12 (1)
P 3693A (1)
P3H3 (1)
P3HR1 cell line (1)
PAI 1 (1)
PAI 1 knockout mouse (1)
PARPBP C12orf48 antibody was produced in Rabbit (1)
PC 1 (1)
PD 107779 (1)
PH 5776 (1)
PLN Phospholamban antibody was produced in Goat (1)
PM 185184 (1)
PM 671 (1)
PMA Mouse Lymphoma Cell (1)
PN 200 110 (1)
PR 82 3 (1)
PS 2383 (1)
PTGER4 EP4 antibody was produced in Rabbit (1)
PTGS2 COX2 COX 2 antibody was produced in Rabbit (1)
Papaver somniferum (1)
Papaya latex (1)
Papillomavirus type 16 (1)
Papillomavirus type 18 (1)
Parvovirus B19 (1)
Peganium harmala seeds (1)
Penicillium griseofulvum (1)
Pentostatin from Streptomyces sp (1)
Pepsin digest of goat anti human IgM (1)
Pepsinized human placenta (1)
Pervanadate treated HepG2 cells (1)
Phaseolus vulgaris E4 lectin (1)
Photinus pyralis (1)
Physostigma venenosum (1)
Pichia yeast (1)
Pig Kidney (1)
Pig Pancreas (1)
Pig skeletal muscle (1)
Pinus spp (1)
Pizotifen (1)
Plant and animal tissue (1)
Platencin (1)
Platensimycin (1)
Pleurotus sp (1)
Podophylum peltatum (1)
Polygonum Hydropiper (1)
Polysaccharides in bacteria (1)
Pooled Female Donors (1)
Pooled Human Plasma (1)
Pooled Normal Human Serum (1)
Pooled defibrinated human serum (1)
Pooled human blood serum plasma (1)
Pooled human donor plasma (1)
Pooled normal bovine serum (1)
Pooled normal canine milk (1)
Pooled normal chicken serum (1)
Pooled normal chimpanzee milk (1)
Pooled normal chimpanzee serum (1)
Pooled normal equine milk (1)
Pooled normal human milk (1)
Pooled normal porcine milk (1)
Populus sieboldii (1)
Porcine Plasma (1)
Porcine Stomach (1)
Porcine Urine (1)
Porcine articular cartilage (1)
Porcine cardiac tissue (1)
Porcine gastric mucosa (1)
Porcine sternal cartilage (1)
Portulaca grandiflora (1)
Pregnacy urine (1)
Prepared from fresh human plasma (1)
Prepared from human plasma (1)
Principal constituent of tree galls (1)
Proprietary Cell Line (1)
Proteus vulgaris (1)
Provided as a lyophilized salt free powder (1)
Providencia stuarti (1)
Provitamin A (1)
Pseudomonas aeruginosa (1)
Pseudomonas alcaligenes Sau14 027 (1)
Pseudomonas atlantica (1)
Pseudomonas diminuta Mck 33 321 (1)
Pseudomonas fluorescens (1)
Pseudomonas fragi mutant strain (1)
Pseudomonas syringae Lki1 pH124 (1)
Purified Bovine GFAP protein (1)
Purified Human Plasma (1)
Purified from Bovine serum (1)
Purified from Goat serum (1)
Purified from Human Plasma (1)
Purified from Rabbit skeletal muscle (1)
Purified from human serum (1)
Purified from pooled normal Porcine serum (1)
Purified from tissue culture supernatant (1)
Purified human liver carcinoma (1)
Purified human liver ferritin (1)
Purified myoglobin (1)
Purulent human sputum (1)
Pylori CultureStrain 43504 (1)
Pylori CultureStrain ATCC 43504 (1)
Quillaja bark (1)
R 12564 (1)
R 14950 (1)
R 1707 (1)
R 18553 (1)
R 23979 (1)
R 25788 (1)
R 33812 (1)
R 41400 (1)
R 42470 (1)
R 47465 (1)
R 51211 (1)
R 5147 (1)
R 516 (1)
R 51619 (1)
R 64433 (1)
R 64766 (1)
R 757 (1)
R 805 (1)
R 8299 (1)
R enatiomer of modafinil 01505361 (1)
R17889 (1)
R41468 (1)
RA 8 (1)
RAB54A RAB5 antibody was produced in Goat (1)
RAB7A RAB7 antibody was produced in Goat (1)
RC 27109 (1)
RC 61 91 (1)
RD 325 (1)
RET antibody was produced in Rabbit (1)
RG 83606 (1)
RH Strain Swiss mice (1)
RH Strain in PBS (1)
RH Strain mice (1)
RMI 9384A (1)
RMI 9918 (1)
RO 1 5130 (1)
RO 13 9297 (1)
RO 13 9904 (1)
RO 14 4767 (1)
RO 2 9915 (1)
RO 22 2296 (1)
RO 24 2027 (1)
RO 4 0403 (1)
RO 4 4393 (1)
RO 4 6467 (1)
RP 14539 (1)
RP 19583 (1)
RP 2275 (1)
RP 2632 (1)
RP 2786 (1)
RP 2921 (1)
RP 3276 (1)
RP 3277 (1)
RP 4753 (1)
RP 54780 (1)
RP 56976 (1)
RP 6140 (1)
RP 7162 (1)
RP 7452 (1)
RP 8595 (1)
RP 866 (1)
RP 8823 (1)
RP 9778 (1)
RS 079070 194 (1)
RS 21592 (1)
RS 35887 (1)
RS 3650 (1)
RS 43285 003 (1)
RS 69216 (1)
RS 8858 (1)
RSV Type A (1)
RU 2267 (1)
RU 23908 (1)
RU 28965 (1)
RU 38486 (1)
RU 486 (1)
RU 965 (1)
RWJ 17021 (1)
RWJ 25213 (1)
Rabbit Fibrinogen (1)
RabbitSource E Coli (1)
Rancid fats and Lycopodium spp (1)
Rat IgG2bk (1)
Rat Mouse (1)
Rat heart (1)
Rat kidney (1)
Rat liver (1)
Rat sternal cartilage (1)
Rat tendon excised from tail (1)
Recombinant E (1)
Recombinant Human RAP produced in E Coli (1)
Recombinant Phage Display (1)
Recombinant Pichia pastoris (1)
Recombinant protein encoding human (1)
Recombinant protein expressed in Sf21 cells (1)
Red Kidney Bean (1)
Red kidney bean (1)
Reombinant Human E Coli (1)
Retina (1)
Rheum palmatum (1)
Rickettsia conorii (1)
Ro 01 6794 706 (1)
Ro 12 0068 (1)
Ro 13 5057 (1)
Ro 13 8996 (1)
Ro 15 1788 000 (1)
Ro 18 0647 002 (1)
Ro 2 3773 (1)
Ro 2 9757 (1)
Ro 21 5998 (1)
Ro 21 9738 (1)
Ro 4 2130 (1)
Ro 4 3780 (1)
Ro4 4602 (1)
Root extracts of horseradish (1)
Roots of horseradish (1)
Rrv 144 (1)
Rubeola Edmonston strain (1)
Ruta Graveolens (1)
S 2539 F (1)
S 4532 (1)
S 9490 (1)
S 9780 (1)
S facilities (1)
SC 10363 (1)
SC 13957 (1)
SC 18862 (1)
SC 4642 (1)
SC 47111A (1)
SC 9376 (1)
SC 9420 (1)
SCH 10144 (1)
SCH 10649 (1)
SCH 13475 (1)
SCH 14714 (1)
SCH 20569 (1)
SCH 25298 (1)
SCH 4831 (1)
SD 17102 (1)
SDZ 212 713 (1)
SDZ ENA 713 (1)
SE 1702 (1)
SF 733 (1)
SF 86 327 (1)
SGD 301 76 (1)
SK F 14287 (1)
SK F 1995 (1)
SK F 51 (1)
SK F 6539 (1)
SK F 8542 (1)
SK F 96022 (1)
SK F D 75073 Z (1)
SKF 4657 (1)
SKF 62979 (1)
SKF 8898A (1)
SL 29 Host Cell (1)
SL 75212 10 (1)
SL 77499 (1)
SM 224 (1)
SN 13272 (1)
SN 390 (1)
SQ 1089 (1)
SQ 11725 (1)
SQ 13396 (1)
SQ 1489 (1)
SQ 16423 (1)
SQ 16603 (1)
SQ 18566 (1)
SQ 26776 (1)
SQ 6201 (1)
SQ 9453 (1)
SR 25990C (1)
SR 47436 (1)
SR 720 22 (1)
SR 96669 (1)
ST 813 (1)
STGSKQRSQNRSKTC C aa1 14 (1)
SU 101 (1)
SYNEPHRINE (1)
Saccharomyces porispora hiltus (1)
Salamander (1)
Salivary glands of Octopus vulgaris (1)
Salix spp (1)
Salmon Calcitonin (1)
Salmonella enteritidis (1)
Salmonella typhi (1)
Sambucus nigra (1)
Sanguinaria canadensis (1)
Sch 1000 (1)
Sch 15719W (1)
Sch 32088 (1)
Sch 6783 (1)
Sch 9724 (1)
Semi synthetic Moxidectin (1)
Sepharose Affinity Purification (1)
Serratia marcescens MST AS5330 (1)
Shigella flexneri (1)
Shrimph (1)
Silybum marianum (1)
Single Caucasian Donor (1)
Single Human Donors (1)
Snail Helix pomatia (1)
Snake Venom (1)
Source Ascites Host Mouse (1)
Source AscitesHost Mouse (1)
Source Duck (1)
Source Feline (1)
Source Human Cardiac Tissue (1)
Source Human Eosinophils (1)
Source Human Pituitary Glands (1)
Source Human Plasma (1)
Source Human plasma from multiple donors (1)
Source Human_x000D_ (1)
Source Mixed Bovine Spleen and Thymus (1)
Source Mollusk (1)
Source Mouse Ascites (1)
Source Mouse ascitesClone Monoclonal (1)
Source Pigeon (1)
Source Porcine Gastric Mucosa Stomach (1)
Source Rhesus monkey serum (1)
Soya (1)
St 1085 (1)
Staphylcoccus aureus strain V8 (1)
Stephania spp (1)
Steptomyces natalensis (1)
Strain 33153 (1)
Strain 49503 (1)
Strain A New Caledonia 20 99 H1N1 (1)
Strain AD169 MRC 5 (1)
Strain ATCC 33153 (1)
Strain G produced in E6 cells (1)
Strain pHM 175 (1)
Streptococcus agalactiae (1)
Streptococcus faecalis NCTC6783 (1)
Streptococcus griseus (1)
Streptococcus milleri S (1)
Streptococcus pneumoniae (1)
Streptocyces avidinii (1)
Streptomyces Iysosuperficus (1)
Streptomyces Platensis (1)
Streptomyces albus (1)
Streptomyces ambofaciens (1)
Streptomyces aureofaciens (1)
Streptomyces aureofaiens (1)
Streptomyces aureus (1)
Streptomyces cinnamonensis (1)
Streptomyces griseolus (1)
Streptomyces griseus (1)
Streptomyces humidus (1)
Streptomyces kanamyceticus (1)
Streptomyces niveus and S griseus (1)
Streptomyces noursei (1)
Streptomyces orientalis (1)
Streptomyces pactum (1)
Streptomyces peucetius MST AS5775 (1)
Streptomyces ribosidificus (1)
Streptomyces rimosis paramomycinus (1)
Streptomyces rimosus (1)
Streptomyces staurosporeus (1)
Streptomyces tenebrarius (1)
Streptomycetes nodosus (1)
Strptomyces pilosus (1)
Strychnos nux vomica (1)
Strychnos spp (1)
Submaxillary glands (1)
Submaxillary glands of male mice (1)
Sweet Potato (1)
Synthetic B 15000 (1)
Synthetic PDK substrate peptide (1)
Synthetic human NPR C a (1)
Synthetic human beta Defensin 1 peptide a (1)
Synthetic human beta Defensin 2 peptide a (1)
Synthetic human beta Defensin 4 peptide a (1)
Syrian hamster (1)
T 1220 (1)
T 1824 (1)
T 3761 (1)
TACR3 NK3R antibody was produced in Rabbit (1)
TAK 375 (1)
TAK 491 (1)
TE 031 (1)
TEI 6720 (1)
TF Transferrin antibody was produced in Mouse (1)
TG2b murine myeloma cell line (1)
TGN46 TGN38 antibody was produced in Rabbit (1)
TH 1321 (1)
THQ (1)
THR (1)
TMX 67 (1)
TREM2 TREM 2 antibody was produced in Goat (1)
TTR Transthyretin antibody was produced in Goat (1)
Tea and cocoa constituent (1)
Teicoplanin Complex (1)
Telomycin (1)
Tetranactin from Streptomyces sp (1)
Th 22 (1)
The animals were free from infectious diseases (1)
Thermopsis lanceolata (1)
Thermus aquaticus Cc1 331 (1)
Thermus aquaticus YT 1 (1)
This protein is expressed in DS2 cells (1)
Thrombin (1)
Thyroid gland (1)
Tolypocladium inflatum (1)
Torpedo californica (1)
Toxoplasma gondii (1)
Transferrin (1)
Treponema pallidum (1)
Trichoderma sp (1)
Trichomonas vaginalis (1)
Tropaeolum majus (1)
Trypanosoma cruzi (1)
Trypanosoma rangeli (1)
Turkeys (1)
U 100766 (1)
U 101440 (1)
U 10858 (1)
U 17835 (1)
U 18573 (1)
U 2043 (1)
U 21251 (1)
U 26452 (1)
U 27182 (1)
U 36059 (1)
U 4527 (1)
U 6013 (1)
U 64279 (1)
U 8471 (1)
U 9889 (1)
UCB 1967 (1)
UCB 22059 (1)
UCB 6215 (1)
UCB L059 (1)
UCP2 antibody was produced in Goat (1)
UH AC 62XX (1)
UK 109496 (1)
UK 116044 04 (1)
UK 124114 (1)
UK 20349 (1)
UK 33274 27 (1)
UK 88525 04 (1)
UK 92480 10 (1)
UNII 5688UTCO1R (1)
UNII G2B4VE5GH8 (1)
UNII RNZ4305WW5 (1)
UP 83 (1)
UR 1521 (1)
Umbelliferae (1)
Uragoga ipecacuanha (1)
Ureaplasma urealyticum (1)
Urine and Blood (1)
VM 26 (1)
VP 16 213 (1)
VP1 Strain (1)
VR 24 (1)
VR 538 (1)
Various plants (1)
Vegetables (1)
Vero Cells Strain VP1 (1)
Vero CellsStrain VP1 (1)
Vero cell culture Strain (1)
Vero cell cultureStrain Conn (1)
Vero cell cultureStrain Faulkener (1)
Vero cell cultureStrain Long strain ATCC VR 26 (1)
Vero cellsStrain 16681 (1)
Vibrio cholerae (1)
Vibrio species (1)
Vinca rosea (1)
Vincamine Vinca minor (1)
Virginiamycin Complex (1)
Virus BK (1)
Virus Epstein Barr (1)
Virus varicella zoster (1)
Vitamin A palmitate (1)
Vitamin B complex (1)
Vitamin B1 (1)
Vitamin C (1)
W 1655 (1)
W 3207B (1)
W 3566 (1)
W 4565 (1)
W 5219 (1)
W 8495 (1)
WIN 18320 (1)
WIN 40680 (1)
WIN 47203 2 (1)
WIN 5063 2 (1)
WR 142490 (1)
WY 21743 (1)
WY 3277 (1)
WY 44635 (1)
WY 45030 (1)
WY 45233 (1)
WY 5104 (1)
Water soluble derivative of chlorophyll (1)
Wheat germ (1)
Whole cell sonicate (1)
Widespread in animal tissue (1)
Widespread in animals (1)
Widespread in fungi and plants (1)
Widespread in living tissue (1)
Widespread in plants and animals (1)
Widespread in the plant and animal kingdoms (1)
Widespread in the plant and fungal kingdom (1)
Wy 1094 (1)
Wy 806 (1)
XU 62 320 (1)
XX0 (1)
Xanthobacter agilis Vs18 132 (1)
Xanthomonas ampelina Slo 51 021 (1)
Xanthomonas badrii (1)
Xanthomonas holcicola (1)
Xanthomonas maltophilia Jo 21 021 (1)
Xanthomonas maltophilia Jo 85 025 (1)
Xyris semifuscata (1)
YC 93 (1)
YM 67905 (1)
YM 905 (1)
YTR 830H (1)
Yersinia enterocolitica (1)
Z 4942 (1)
Z 6000 (1)
ZD 1033 (1)
ZD 1839 (1)
ZD 5077 (1)
ZK 30595 (1)
ZM 204639 (1)
Zanthoxylum avicennae (1)
Zoonosis (1)
alpha lipoic acid (1)
also Capsicum frutescens Cyperus spp (1)
also in Pisum sativum (1)
and HIV 1 and 2 antibodies (1)
animal protein (1)
ascites fluid from tumors (1)
bayk 5552 (1)
brain (1)
burgdorferi cultureStrain B31 Low Passage (1)
catechin (1)
cmpd 83405 (1)
coli Full length protein P0DN86 (1)
cultured in Vero cells (1)
dates and Punica granatum seeds (1)
enantomer of lansoprazole 01503926 (1)
esp Quercus spp (1)
facilities (1)
from CHO cells (1)
from a crude lysate (1)
from human liver (1)
from human neutrophil (1)
from human saliva (1)
from human seminal fluid (1)
from human spleen (1)
from human urine (1)
from mouse plasma (1)
from porCine heart (1)
from porcine plasma (1)
fruits and grasses (1)
gamma Globulin (1)
gene denV in E Coli (1)
green plants and fungi (1)
griseus (1)
hepatotoxic (1)
higher plants (1)
host (1)
human heart (1)
invertebrates (1)
kidney (1)
lavender oil (1)
liver (1)
luzonensis (1)
many plants and animals (1)
mouse fibroblasts (1)
mp 94 deg C (1)
myeloma cells with spleen cells from Balb c mice (1)
negative for HbsAG (1)
normal brain (1)
other Penicillium spp (1)
p16INK4a antibody was produced in Mouse (1)
pastoris (1)
pastoris expression system (1)
perfringens (1)
podophylotoxin (1)
polymyxin E (1)
purified by ultracentrifugation (1)
pylori culture (1)
pyrithioxin (1)
red kidney bean (1)
renal metabolite (1)
rutin 7 (1)
salbutamol (1)
single patient (1)
stable clone (1)
strain 1 (1)
striated muscle (1)
sugar beet (1)
synthetis (1)
then modified with tetranitromethane1 (1)
thioctic acid amide (1)
tonka beans (1)
using only domestic animal materials (1)
vertebrates (1)
wheat germ and other plant oils (1)
whey and urine (1)
widely distributed in plants (1)
widespread in plants and animals (1)
with MIC90 of 0 (1)
yeasts (1)
Tissue
Virus
Disease
SKU
Product name
Supplier
Catalog no.
Size
Price
No results were found for the given phrase
01010000006
Anti-Mouse LIF
Info
Reliatech antibodies
103-PA05S
100ug
Ask
Ask
01010000008
Anti-Human IL-17
Info
Reliatech antibodies
101-M483
100ug
Ask
Ask
01010000009
Anti-Human TGFR-1 (ALK-1)
Info
Reliatech antibodies
101-M95
100ug
Ask
Ask
01010000011
Mouset Wnt-3a (5 ug) Growth Factor
Info
101biosystem
P702-5
5 ug
Ask
Ask
01010000012
Anti-Human Integrin alpha 5
Info
Reliatech antibodies
101-M518
100ug
Ask
Ask
01010000013
Anti-Human Galectin-1
Info
Reliatech antibodies
102-PA131AG
50ug
Ask
Ask
01010000015
Anti-Snake VEGF-F (Bothrops insularis)
Info
Reliatech antibodies
105-PA01
200ug
Ask
Ask
01010000017
Anti-Mouse Podoplanin
Info
Reliatech antibodies
103-PA40
200ug
Ask
Ask
01010000018
Anti-Mouse KC (CXCL1)
Info
Reliatech antibodies
103-P23
100ug
Ask
Ask
01010000019
Anti-Human CD163
Info
Reliatech antibodies
101-M291
100ug
Ask
Ask
01010000021
Anti-Human IL-1 R2
Info
Reliatech antibodies
101-M467
100ug
Ask
Ask
01010000022
Anti-Human Junctional adhesion molecule B (JAM-B)
Info
Reliatech antibodies
101-M525
100ug
Ask
Ask
01010000024
Anti-Human CCL-15
Info
Reliatech antibodies
101-M258
100ug
Ask
Ask
01010000025
Anti-Human Integrin alpha X
Info
Reliatech antibodies
101-M522
100ug
Ask
Ask
01010000026
Anti-Human Coagulation Factor X
Info
Reliatech antibodies
101-M331
100ug
Ask
Ask
01010000027
Anti-Human VEGFR-1/Flt-1
Info
Reliatech antibodies
101-M30
100ug
Ask
Ask
01010000028
Anti-Human IL-8
Info
Reliatech antibodies
102-P38
100ug
Ask
Ask
01010000029
DKK-1, human
Info
101biosystem
P705-100
100 ug
Ask
Ask
01010000030
Anti-Human KIR2DL4
Info
Reliatech antibodies
101-M541
100ug
Ask
Ask
01010000032
Anti-Human Resistin
Info
Reliatech antibodies
102-P92G
100ug
Ask
Ask
01010000033
Long-term Cell Tracer 580 (Yellow)
Info
101biosystem
P710Y
1mL
Ask
Ask
01010000034
Anti-Human LEC
Info
Reliatech antibodies
101-M73
500ug
Ask
Ask
01010000035
Anti-Human TNF-alpha
Info
Reliatech antibodies
101-M17
500ug
Ask
Ask
01010000036
Anti-Human BRAK
Info
Reliatech antibodies
102-P223
100ug
Ask
Ask
01010000038
Anti-Human IGF-BP4
Info
Reliatech antibodies
101-M460
100ug
Ask
Ask
01010000039
Anti-Mouse CXCL7
Info
Reliatech antibodies
103-M362
100ug
Ask
Ask
01010000040
Anti-Human CD16
Info
Reliatech antibodies
101-M290
100ug
Ask
Ask
01010000041
Anti-Human IL-4
Info
Reliatech antibodies
101-M05
500ug
Ask
Ask
01010000043
Anti-Mouse TIE-2
Info
Reliatech antibodies
103-M55
200ug
Ask
Ask
01010000045
Anti-Rat GRO-beta/KC
Info
Reliatech antibodies
104-P20
100ug
Ask
Ask
01010000046
Anti-Mouse ICAM-1
Info
Reliatech antibodies
103-M97
200ug
Ask
Ask
01010000048
Anti-Mouse PlGF
Info
Reliatech antibodies
103-M03
100ug
Ask
Ask
01010000049
Anti-Human IL-19
Info
Reliatech antibodies
102-P235
100ug
Ask
Ask
01010000050
TGF-b1, human
Info
101biosystem
P708-100
100 ug
Ask
Ask
01010000052
Anti-Mouse Axl
Info
Reliatech antibodies
103-M158
100ug
Ask
Ask
01010000054
Anti-Mouse Semaphorin 6A
Info
Reliatech antibodies
103-M463
100ug
Ask
Ask
01010000056
Anti-Human NT-3
Info
Reliatech antibodies
101-M592
100ug
Ask
Ask
01010000057
Anti-Human CD80
Info
Reliatech antibodies
101-M315
100ug
Ask
Ask
01010000058
Anti-Human BMP-4
Info
Reliatech antibodies
101-M235
100ug
Ask
Ask
01010000060
Anti-Human HMGB1
Info
Reliatech antibodies
101-M452
100ug
Ask
Ask
01010000061
Anti-Human CD299
Info
Reliatech antibodies
101-M302
100ug
Ask
Ask
01010000062
Anti-Human CD97
Info
Reliatech antibodies
101-M320
100ug
Ask
Ask
01010000066
Anti-Human CLEC-1
Info
Reliatech antibodies
101-M325
100ug
Ask
Ask
01010000067
Anti-Mouse Follistatin-Related Gene Protein (FLRG)
Info
Reliatech antibodies
103-M222
100ug
Ask
Ask
01010000069
Anti-Mouse RELM beta
Info
Reliatech antibodies
103-P50
100ug
Ask
Ask
01010000072
Anti-Human MIP-3
Info
Reliatech antibodies
102-P66
100ug
Ask
Ask
01010000073
Anti-Human FGF-8
Info
Reliatech antibodies
101-M412
100ug
Ask
Ask
01010000075
Anti-Human NT-4
Info
Reliatech antibodies
101-M15
500ug
Ask
Ask
01010000078
Ultra SYBR Green qPCR Master Mix (2X, with ROX I)
Info
101biosystem
W2601-5
5 mL
Ask
Ask
01010000079
Anti-Mouse CD40 Ligand
Info
Reliatech antibodies
103-M142
200ug
Ask
Ask
Filters
Sitemap
Contact
$
EUR
GBP
PLN
USD
Login or register
X
Total
products
: 13 035 472
Current
page
:
1
Go to first
|
Next
AHR 619
Capsicum spp
Coccidioides immitis
Host Donkey
Purified from tissue culture supernatant
Clear all
Compact list
Compact list
Extended list
Compact list
Compact list
Extended list
Sitemap
Contact
Currency: $
EUR
GBP
PLN
USD
Cart
Login or register
Contact us
Send
Close